(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE258

AE017197.PE258       Location/Qualifiers
FT   CDS             complement(337676..338362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0268"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03748"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X94"
FT                   /protein_id="AAU03748.1"
FT                   /translation="MPFRYKRINIEKHNKSDFKSLDMMLNQNYFYQNKFEEIRESYLAD
FT                   RKVQENPKYLSDPQLRAKVEKYFEKTAWDLLLNYIVGVKEAAFYLASSYINGYGVDQDE
FT                   FLSNLTLAVGVKLGDKRSIKMLDGEAPLPTYIQKFADRCIKEIKKHKKEVQNRDVSCEE
FT                   IMARAKAFDYFVKTNTKHSYYDTIHEKNNASMKHFAYYVEPIIENNSQDQLEAIGQLTK
FT                   FHCEIC"
     MPFRYKRINI EKHNKSDFKS LDMMLNQNYF YQNKFEEIRE SYLADRKVQE NPKYLSDPQL        60
     RAKVEKYFEK TAWDLLLNYI VGVKEAAFYL ASSYINGYGV DQDEFLSNLT LAVGVKLGDK       120
     RSIKMLDGEA PLPTYIQKFA DRCIKEIKKH KKEVQNRDVS CEEIMARAKA FDYFVKTNTK       180
     HSYYDTIHEK NNASMKHFAY YVEPIIENNS QDQLEAIGQL TKFHCEIC                    228
//

If you have problems or comments...

PBIL Back to PBIL home page