(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE260

AE017197.PE260       Location/Qualifiers
FT   CDS             341040..341273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0270"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03750"
FT                   /db_xref="GOA:Q68X92"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X92"
FT                   /protein_id="AAU03750.1"
FT                   /translation="MGNQEDKMLTLESYIDEEVDKRLNAKNARKELKLILITFAIILTS
FT                   FLTFTYFFLDYIEEKASSYKLQHKQKEMNKTK"
     MGNQEDKMLT LESYIDEEVD KRLNAKNARK ELKLILITFA IILTSFLTFT YFFLDYIEEK        60
     ASSYKLQHKQ KEMNKTK                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page