(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE263

AE017197.PE263       Location/Qualifiers
FT   CDS             complement(345773..347314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0273"
FT                   /product="HyfB domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03753"
FT                   /db_xref="GOA:Q68X89"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X89"
FT                   /protein_id="AAU03753.1"
FT                   /translation="MFIQNTKFTFPFTNFNLIFDFNPQNQLIALSFIIITTILNLYTIS
FT                   KKRKLECLIGSLYCLSSIVCVFAADFISMIISIEFMTIFTCIIIFCEQLKIQPLRQYFI
FT                   THLFSSGLILIGMTLQITTISNTAFISLTESVNHFKLPSILILTGCLINAATIFVNGWV
FT                   VNCYPAASSSGVVYLISFTTKVSLIIILKLFSGLEILKLFGISMMIYGLVLSLIEKNLK
FT                   RLICYLTISQLGFILAAISINTPNIAYLITSFIFMHILYNGLFALYFTYIEDEYGIKNY
FT                   QDLHKSSINLNLLIGFVISILIYISILPMRSSYIKNAIANILNEENIMLFFKIITCTVL
FT                   FELLLESLHLLYRRASRICNTNIKPFSIIEYFLNNALKTRHDIITILYLHCCIITLFLC
FT                   LLYPIQISHNTNSNQLIIITISLLLALIFRKIPRISTENINLDLYQYIEKLIFFIVDKY
FT                   TEKYDKKNVEAHINLKAILDNILSKISAWHNQQTAIFIVLFLLISFILTLYYTST"
     MFIQNTKFTF PFTNFNLIFD FNPQNQLIAL SFIIITTILN LYTISKKRKL ECLIGSLYCL        60
     SSIVCVFAAD FISMIISIEF MTIFTCIIIF CEQLKIQPLR QYFITHLFSS GLILIGMTLQ       120
     ITTISNTAFI SLTESVNHFK LPSILILTGC LINAATIFVN GWVVNCYPAA SSSGVVYLIS       180
     FTTKVSLIII LKLFSGLEIL KLFGISMMIY GLVLSLIEKN LKRLICYLTI SQLGFILAAI       240
     SINTPNIAYL ITSFIFMHIL YNGLFALYFT YIEDEYGIKN YQDLHKSSIN LNLLIGFVIS       300
     ILIYISILPM RSSYIKNAIA NILNEENIML FFKIITCTVL FELLLESLHL LYRRASRICN       360
     TNIKPFSIIE YFLNNALKTR HDIITILYLH CCIITLFLCL LYPIQISHNT NSNQLIIITI       420
     SLLLALIFRK IPRISTENIN LDLYQYIEKL IFFIVDKYTE KYDKKNVEAH INLKAILDNI       480
     LSKISAWHNQ QTAIFIVLFL LISFILTLYY TST                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page