(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE266

AE017197.PE266       Location/Qualifiers
FT   CDS             complement(351086..351421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0276"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03756"
FT                   /db_xref="GOA:Q68X86"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X86"
FT                   /protein_id="AAU03756.1"
FT                   /translation="MHLLIYFLTLILFTSGLFIMLTSHNYIHKIIGLGIFQSPVLLFFL
FT                   SIGKIKTGGVPILQDGINTYTSPLPHVLILTAIVVGFATLSVALSLIYQIYKHYGTVSA
FT                   NEVNVDK"
     MHLLIYFLTL ILFTSGLFIM LTSHNYIHKI IGLGIFQSPV LLFFLSIGKI KTGGVPILQD        60
     GINTYTSPLP HVLILTAIVV GFATLSVALS LIYQIYKHYG TVSANEVNVD K                111
//

If you have problems or comments...

PBIL Back to PBIL home page