(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE269

AE017197.PE269       Location/Qualifiers
FT   CDS             353439..353618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0279"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03759"
FT                   /db_xref="InterPro:IPR024444"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X83"
FT                   /protein_id="AAU03759.1"
FT                   /translation="MLKSLKFLLVFIMIAQLLSCTPSAPYEIKSPCVSADIDDNSNLSV
FT                   NPCIRRPINALNIV"
     MLKSLKFLLV FIMIAQLLSC TPSAPYEIKS PCVSADIDDN SNLSVNPCIR RPINALNIV         59
//

If you have problems or comments...

PBIL Back to PBIL home page