(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE28

AE017197.PE28        Location/Qualifiers
FT   CDS             complement(36090..39005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0030"
FT                   /product="VirB6-like protein of the type IV secretion
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:RT0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03518"
FT                   /db_xref="GOA:Q68XX4"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XX4"
FT                   /protein_id="AAU03518.1"
FT                   /translation="MQSNLLKVLGVLAIVATLVCFIFAALGMIGAVRIGNGCYMRYSKD
FT                   GNGGADSITNTITLNANANYFNISKMLPDGTTKLIPDPNRYGEWLNTQVLVEKNQQVNL
FT                   QVVGQVSLCLAYLPKNNLQFTERTRPGKSNLDDSNQMIPIPRVQDANSPPVSLIMDAKN
FT                   NEWRNIAELYANDKVLVSVSPNFANTDATVDDVFKGVKVTKDCTQGKTSYYPICGKYSI
FT                   YSGKYVTACELKQNYWKGNVHREECYCVFGCIYQEENEQWICDAANSASHCCTSLVCDS
FT                   LPAWINHYSNMPEAYKDDGSFTFSWSDKSGNLLIDYQDLQCSNNVQIPPNGECPDIVDN
FT                   RNPKDKDYIGGVHCTSGICKDGDFQKNRKFWYTADGKGGKGPTGLIYQMNNTGSVSQAL
FT                   PSNLEFAKFVPETEQPPEYKDKNGKYLYKVIYNIPFNSNIEKSYLQYRLWSPTSQDSSK
FT                   NTGGYVLNIKQTKCYRENGNSFKDIFDDRGRVQYIIVQSSENPNTSGKTYAPQGINVDS
FT                   DGKSHFNANEAGYIWMKILNDPSNNLKDYKDSEGSYKVHFSTSLKVGSFTIKVMNPLLQ
FT                   LFKTKVQGAATSIFKNMVCYKSTDNTSCTNFFTYIKAILILYVMTYGAMFLLGFAKINQ
FT                   KELVIRIAKIGMVSGLINGNTFEFFNNYLFDAITNFSDSIIANMSGYSLFTSTNTISNP
FT                   FMFLDAIMSKIFFSQTFIAQLLSLLSLGLSGIIYFIITFIAVCIVIITTLRAIAVYIMA
FT                   FMATCILIGIAPLFISFLLFDFTRYLFDNWVRFTIRYMIEPVVMMAGIIVLTQLFTIYL
FT                   DFVLGYSVCWKCTLPIKIPFIGTILPIALLNVPIFCINWFAPWGMDYMSGMMGVNMQNI
FT                   VALVIIAYGMYGYVEFSGRMVAKLTSAAGPSATQIGDRMSHDAGQKTLSQIGMDYRTRK
FT                   GITSRAKSRLKQRNRTLEHAEQNSKKYMKKIGENTNEGTLK"
     MQSNLLKVLG VLAIVATLVC FIFAALGMIG AVRIGNGCYM RYSKDGNGGA DSITNTITLN        60
     ANANYFNISK MLPDGTTKLI PDPNRYGEWL NTQVLVEKNQ QVNLQVVGQV SLCLAYLPKN       120
     NLQFTERTRP GKSNLDDSNQ MIPIPRVQDA NSPPVSLIMD AKNNEWRNIA ELYANDKVLV       180
     SVSPNFANTD ATVDDVFKGV KVTKDCTQGK TSYYPICGKY SIYSGKYVTA CELKQNYWKG       240
     NVHREECYCV FGCIYQEENE QWICDAANSA SHCCTSLVCD SLPAWINHYS NMPEAYKDDG       300
     SFTFSWSDKS GNLLIDYQDL QCSNNVQIPP NGECPDIVDN RNPKDKDYIG GVHCTSGICK       360
     DGDFQKNRKF WYTADGKGGK GPTGLIYQMN NTGSVSQALP SNLEFAKFVP ETEQPPEYKD       420
     KNGKYLYKVI YNIPFNSNIE KSYLQYRLWS PTSQDSSKNT GGYVLNIKQT KCYRENGNSF       480
     KDIFDDRGRV QYIIVQSSEN PNTSGKTYAP QGINVDSDGK SHFNANEAGY IWMKILNDPS       540
     NNLKDYKDSE GSYKVHFSTS LKVGSFTIKV MNPLLQLFKT KVQGAATSIF KNMVCYKSTD       600
     NTSCTNFFTY IKAILILYVM TYGAMFLLGF AKINQKELVI RIAKIGMVSG LINGNTFEFF       660
     NNYLFDAITN FSDSIIANMS GYSLFTSTNT ISNPFMFLDA IMSKIFFSQT FIAQLLSLLS       720
     LGLSGIIYFI ITFIAVCIVI ITTLRAIAVY IMAFMATCIL IGIAPLFISF LLFDFTRYLF       780
     DNWVRFTIRY MIEPVVMMAG IIVLTQLFTI YLDFVLGYSV CWKCTLPIKI PFIGTILPIA       840
     LLNVPIFCIN WFAPWGMDYM SGMMGVNMQN IVALVIIAYG MYGYVEFSGR MVAKLTSAAG       900
     PSATQIGDRM SHDAGQKTLS QIGMDYRTRK GITSRAKSRL KQRNRTLEHA EQNSKKYMKK       960
     IGENTNEGTL K                                                            971
//

If you have problems or comments...

PBIL Back to PBIL home page