(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE29

AE017197.PE29        Location/Qualifiers
FT   CDS             complement(39009..41033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0031"
FT                   /product="VirB6-like protein of the type IV secretion
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:RT0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03519"
FT                   /db_xref="GOA:Q68XX3"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XX3"
FT                   /protein_id="AAU03519.1"
FT                   /translation="MKTLKALKIFIIVYISSVSLESFAGFGESCSNLPITSDGYLETYT
FT                   AYGYIIRSIDMKDPRGNCNPYTSSITFCFKNVEGSTSPCTIYTLNEGDARKISDLSTDN
FT                   NPNLGANTVLKNIVLTVKKFGNDLCLAMPTSRGPMPVACKSLNATPAPTNPKYENCNIG
FT                   KSCYTGANYSQSLINFSGLAVQCLSETLNKIFFTGNSCSSQDQNSRITHLAAFSTFQGY
FT                   LKRIIGAALILYTMFFAFNMALNKEYATTEKITLFIIKFLFVVYFSIGLEPLNFSGGQT
FT                   VKENGMLKYGLPLLTGAAPDFAEMIFNAAGSRGLCQFDNSKYKDGYKFYGLWDAIDCRI
FT                   GYYLGLDLLYNIDKNGILGHSVGNGPGGNNKPIPNFDPDSKKDRPHDLSKAGALRFFTV
FT                   MFGFLMSGHIIILVAGIAFSVIFLSILLYFITHYLVCMITIYVMTYISPIFIPMVLFTR
FT                   TKAYFDGWVKVCISCALQPAVVAGFIALLITMYDSAIFKNCEFLRYDYEKGDIRFSTFE
FT                   LRLPSIDADKCQESFGYKMLKYYAGEGWEEHLLILFPIKSIVRDVVSILAELLCVLVFS
FT                   VIFYYFSKSIGRFAADLTNGPNMDAVTASPTKIVDLVKKGAAFLQDASSVHAQGKSPVE
FT                   DKPDIGSKRKDGVQQGEDSENSSGGELADLASGSGGGKL"
     MKTLKALKIF IIVYISSVSL ESFAGFGESC SNLPITSDGY LETYTAYGYI IRSIDMKDPR        60
     GNCNPYTSSI TFCFKNVEGS TSPCTIYTLN EGDARKISDL STDNNPNLGA NTVLKNIVLT       120
     VKKFGNDLCL AMPTSRGPMP VACKSLNATP APTNPKYENC NIGKSCYTGA NYSQSLINFS       180
     GLAVQCLSET LNKIFFTGNS CSSQDQNSRI THLAAFSTFQ GYLKRIIGAA LILYTMFFAF       240
     NMALNKEYAT TEKITLFIIK FLFVVYFSIG LEPLNFSGGQ TVKENGMLKY GLPLLTGAAP       300
     DFAEMIFNAA GSRGLCQFDN SKYKDGYKFY GLWDAIDCRI GYYLGLDLLY NIDKNGILGH       360
     SVGNGPGGNN KPIPNFDPDS KKDRPHDLSK AGALRFFTVM FGFLMSGHII ILVAGIAFSV       420
     IFLSILLYFI THYLVCMITI YVMTYISPIF IPMVLFTRTK AYFDGWVKVC ISCALQPAVV       480
     AGFIALLITM YDSAIFKNCE FLRYDYEKGD IRFSTFELRL PSIDADKCQE SFGYKMLKYY       540
     AGEGWEEHLL ILFPIKSIVR DVVSILAELL CVLVFSVIFY YFSKSIGRFA ADLTNGPNMD       600
     AVTASPTKIV DLVKKGAAFL QDASSVHAQG KSPVEDKPDI GSKRKDGVQQ GEDSENSSGG       660
     ELADLASGSG GGKL                                                         674
//

If you have problems or comments...

PBIL Back to PBIL home page