(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE302

AE017197.PE302       Location/Qualifiers
FT   CDS             395599..396630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0312"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03792"
FT                   /db_xref="GOA:Q68X50"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X50"
FT                   /protein_id="AAU03792.1"
FT                   /translation="MLKNLLKTKLSLVIISLTITILMTLINFSIFYVLMPGNLAQNKTI
FT                   IIEPKLSVNQIVTKLYFNKVIKYPIIFKVIAKIYSITRPIKSGEYVFTRNISPIQTLRI
FT                   LASGKSIIHKIVVPEGTVVSDVIKKINEESRLFGAIKGIIPEGFLMPSTYFFSYGDQKD
FT                   QIIDQMRNLMSINLDKVMKHLAPDSPLKTRIEVLTLASIIEKEAGSNAEKPIIAAVFIN
FT                   RLKKNMKLQADPTTIYALTEGKFKLARALTKKDLLRKLPYNTYYIKGLPPGPIACPSLK
FT                   SLEAVVKPAKTDALFFVVDGKGGHHFSNNLNDHNRFVEIYRKSLIKVPETPIDLKNTKK
FT                   KYE"
     MLKNLLKTKL SLVIISLTIT ILMTLINFSI FYVLMPGNLA QNKTIIIEPK LSVNQIVTKL        60
     YFNKVIKYPI IFKVIAKIYS ITRPIKSGEY VFTRNISPIQ TLRILASGKS IIHKIVVPEG       120
     TVVSDVIKKI NEESRLFGAI KGIIPEGFLM PSTYFFSYGD QKDQIIDQMR NLMSINLDKV       180
     MKHLAPDSPL KTRIEVLTLA SIIEKEAGSN AEKPIIAAVF INRLKKNMKL QADPTTIYAL       240
     TEGKFKLARA LTKKDLLRKL PYNTYYIKGL PPGPIACPSL KSLEAVVKPA KTDALFFVVD       300
     GKGGHHFSNN LNDHNRFVEI YRKSLIKVPE TPIDLKNTKK KYE                         343
//

If you have problems or comments...

PBIL Back to PBIL home page