(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE305

AE017197.PE305       Location/Qualifiers
FT   CDS             397709..398281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0315"
FT                   /product="BioY family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03795"
FT                   /db_xref="GOA:Q68X47"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X47"
FT                   /protein_id="AAU03795.1"
FT                   /translation="MNSLFKILYLNRFVAHLNTNTYILDIVKIVIGVVAIFASAQITIP
FT                   IKPVAITMHSVILCIIAFTYSPRLSFLTILTFIFIGIMGLPVFCQFSSGINYFLGAAGG
FT                   YYLGFLIGIPVMSVLKGKLAENWVNVTIICIIGHIIFYLCGVIWLASIIGLKQAIYSGF
FT                   VIFIPSGLAKLLIFSCLFSYIKNIKSK"
     MNSLFKILYL NRFVAHLNTN TYILDIVKIV IGVVAIFASA QITIPIKPVA ITMHSVILCI        60
     IAFTYSPRLS FLTILTFIFI GIMGLPVFCQ FSSGINYFLG AAGGYYLGFL IGIPVMSVLK       120
     GKLAENWVNV TIICIIGHII FYLCGVIWLA SIIGLKQAIY SGFVIFIPSG LAKLLIFSCL       180
     FSYIKNIKSK                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page