(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE309

AE017197.PE309       Location/Qualifiers
FT   CDS             complement(405132..406067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0319"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03799"
FT                   /db_xref="GOA:Q68X43"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X43"
FT                   /protein_id="AAU03799.1"
FT                   /translation="MEYALLIFSIITILVIIQMVKVVPQQQAWVVEKLGKFDKVLQPGL
FT                   NFLIPIIQRVAYKHTLKEEAIDVTAQTAISNDNVTLSIDGVLYVKIIDPMAASYGVNNP
FT                   YYAITQLAQTTMRSEIGKLPLDRTFEERDALNVAIVSAINQASINWGIQCMRYEIKDIQ
FT                   PPQTILKAMELQVAAERQKRAQILESEGNRQAKINHAEGEKAQIVLNSEASYTDQVNRA
FT                   KGEAEAIGLVATATANSIEIVATAIQKTGGSDAVALKIAEQYINAFGNLAKDTNTVILP
FT                   TNLSEPSSFVTGALSIFNQLKASSDQKRDK"
     MEYALLIFSI ITILVIIQMV KVVPQQQAWV VEKLGKFDKV LQPGLNFLIP IIQRVAYKHT        60
     LKEEAIDVTA QTAISNDNVT LSIDGVLYVK IIDPMAASYG VNNPYYAITQ LAQTTMRSEI       120
     GKLPLDRTFE ERDALNVAIV SAINQASINW GIQCMRYEIK DIQPPQTILK AMELQVAAER       180
     QKRAQILESE GNRQAKINHA EGEKAQIVLN SEASYTDQVN RAKGEAEAIG LVATATANSI       240
     EIVATAIQKT GGSDAVALKI AEQYINAFGN LAKDTNTVIL PTNLSEPSSF VTGALSIFNQ       300
     LKASSDQKRD K                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page