(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE341

AE017197.PE341       Location/Qualifiers
FT   CDS             443221..444384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0352"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03831"
FT                   /db_xref="InterPro:IPR020168"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X11"
FT                   /protein_id="AAU03831.1"
FT                   /translation="MATKNKKEIVNNETKNLANLIIKEIGKENFDFGILKKMQQAFSTA
FT                   SKQKQREAFINILDTKLNKEQLHQLNQTIMQNADELMPDNDPNFVCRTTNNKVFQEILL
FT                   LEAKRSGMQARFSDTGSLQSLDIKDITPEILDHYRVLQEKFYSKRNSKDSIDSRIAQSI
FT                   NFLLYAPLFRESDIYKKLGLKSAEIEREIQDPNGKYVKQLLDAKIGSYTHLYMEVKENN
FT                   VHAGKEIEIASIIEKVMLKFEQDKKISLEGKRRDEITKYLSKSLEGASDYVLTFKKNDL
FT                   VDVIYQGLDKGQTLWSKLVNHIGIKSYSISKENIKVVAQIINNKIKSYHTPLKIEVHDK
FT                   LKQISKELNRLNNPVLPSEAQKVQVKSKKPPIAPKPGHLKKRDHRLC"
     MATKNKKEIV NNETKNLANL IIKEIGKENF DFGILKKMQQ AFSTASKQKQ REAFINILDT        60
     KLNKEQLHQL NQTIMQNADE LMPDNDPNFV CRTTNNKVFQ EILLLEAKRS GMQARFSDTG       120
     SLQSLDIKDI TPEILDHYRV LQEKFYSKRN SKDSIDSRIA QSINFLLYAP LFRESDIYKK       180
     LGLKSAEIER EIQDPNGKYV KQLLDAKIGS YTHLYMEVKE NNVHAGKEIE IASIIEKVML       240
     KFEQDKKISL EGKRRDEITK YLSKSLEGAS DYVLTFKKND LVDVIYQGLD KGQTLWSKLV       300
     NHIGIKSYSI SKENIKVVAQ IINNKIKSYH TPLKIEVHDK LKQISKELNR LNNPVLPSEA       360
     QKVQVKSKKP PIAPKPGHLK KRDHRLC                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page