(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE351

AE017197.PE351       Location/Qualifiers
FT   CDS             458514..459878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0362"
FT                   /product="Sec7-domain containing protein transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03841"
FT                   /db_xref="GOA:Q68X01"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="InterPro:IPR023394"
FT                   /db_xref="InterPro:IPR035999"
FT                   /db_xref="InterPro:IPR038075"
FT                   /db_xref="InterPro:IPR040917"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X01"
FT                   /protein_id="AAU03841.1"
FT                   /translation="MDSLLKNEVIKLFNDKQKSGITRIKKWCADNNKDFIEETAKFFYE
FT                   EKSNLNLEFVGDYLGTDGVDNQKVLESFTKKFDFKDKDYLESLRRFLQSFKLPGEAQKI
FT                   DRLVESFGTHYYEQNLNIDINSKDAAYILAYQAIMLNTDLHNPSIAKSKKMTFEQLKNN
FT                   LKGTNENKNFNDNFLKKIYDEIEAKPFKLNFVDSSPGYQINNISSQNDKVFKQLNQFLE
FT                   EKRNIQNIFPKLQNNNLTIEFKNAKTFLNKFTGYKGNVIIQDEQCGKAEIQVYKPSIFS
FT                   RWFLGEKSKIIIQPLREDGKQPSEQSLELAAQITASFETEVTSIKATYDYLKEDLKSKY
FT                   DNIRNAKQELERISTIAEGHKNIKTEVVYQINQPVKNSVAVSTISVVSPMSKDDIHINP
FT                   PPLPLPKSIPNVVKKAAKDISKQIPQERDNHKEELSKVLEVQRKKIDKQNSGRVV"
     MDSLLKNEVI KLFNDKQKSG ITRIKKWCAD NNKDFIEETA KFFYEEKSNL NLEFVGDYLG        60
     TDGVDNQKVL ESFTKKFDFK DKDYLESLRR FLQSFKLPGE AQKIDRLVES FGTHYYEQNL       120
     NIDINSKDAA YILAYQAIML NTDLHNPSIA KSKKMTFEQL KNNLKGTNEN KNFNDNFLKK       180
     IYDEIEAKPF KLNFVDSSPG YQINNISSQN DKVFKQLNQF LEEKRNIQNI FPKLQNNNLT       240
     IEFKNAKTFL NKFTGYKGNV IIQDEQCGKA EIQVYKPSIF SRWFLGEKSK IIIQPLREDG       300
     KQPSEQSLEL AAQITASFET EVTSIKATYD YLKEDLKSKY DNIRNAKQEL ERISTIAEGH       360
     KNIKTEVVYQ INQPVKNSVA VSTISVVSPM SKDDIHINPP PLPLPKSIPN VVKKAAKDIS       420
     KQIPQERDNH KEELSKVLEV QRKKIDKQNS GRVV                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page