(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE370

AE017197.PE370       Location/Qualifiers
FT   CDS             complement(484129..485130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0383"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03860"
FT                   /db_xref="GOA:Q68WY2"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WY2"
FT                   /protein_id="AAU03860.1"
FT                   /translation="MQKFLSLIIVILILYNIVKLKIYPEDNNNSTTIEQITSNNSSTNA
FT                   HQASINNEPTISLNGNLFERTVSKIVINALKTEEGKVFFENILQPLNGPINPNDYTIEV
FT                   HKDLVKTLFKINTFGSGNIGPASCGHVVTVFYQISDMNNNLISEDTKTFTLGSAPVMLG
FT                   LDNVIIGMMVGESREAIIPAKYTVNNSNNTIFDDAYNYKVTVILKSILPQNFVKSNKVK
FT                   IYDDEIAYRVPLLCGEKVSFNAKITRLSNGKILFDSKSTGQPIDMKIGDITYPLIFSYA
FT                   LQGKVQVGTRSVIAESKTFKALGSNLNKVIPHESLPIHEYLLLELNDFKQIK"
     MQKFLSLIIV ILILYNIVKL KIYPEDNNNS TTIEQITSNN SSTNAHQASI NNEPTISLNG        60
     NLFERTVSKI VINALKTEEG KVFFENILQP LNGPINPNDY TIEVHKDLVK TLFKINTFGS       120
     GNIGPASCGH VVTVFYQISD MNNNLISEDT KTFTLGSAPV MLGLDNVIIG MMVGESREAI       180
     IPAKYTVNNS NNTIFDDAYN YKVTVILKSI LPQNFVKSNK VKIYDDEIAY RVPLLCGEKV       240
     SFNAKITRLS NGKILFDSKS TGQPIDMKIG DITYPLIFSY ALQGKVQVGT RSVIAESKTF       300
     KALGSNLNKV IPHESLPIHE YLLLELNDFK QIK                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page