(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE38

AE017197.PE38        Location/Qualifiers
FT   CDS             complement(52034..52813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0041"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03528"
FT                   /db_xref="GOA:Q68XW4"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XW4"
FT                   /protein_id="AAU03528.1"
FT                   /translation="MLLNIANLVGKHTIKFAQSVGIFALFSFIAISSIIKPPLYLSLIM
FT                   RQLLFIGFHSLPVVAMTTFFSGAVLALQSYTGFSRFSAENSIATVVVLSLTRELGPVLA
FT                   GLIVAGRVGASIAAEIATMKVTEQVDALYTLSTDPIKYLVCPRVIAAIITMPCLVLIGD
FT                   VIGVMGGYLVGIYKLNFNSTAYLTSTFQYLELIDVISGLVKATVFGFIISIISCYSGYY
FT                   SGKGAKGVGRATTSAVVNSSILILISNYLITELLFKV"
     MLLNIANLVG KHTIKFAQSV GIFALFSFIA ISSIIKPPLY LSLIMRQLLF IGFHSLPVVA        60
     MTTFFSGAVL ALQSYTGFSR FSAENSIATV VVLSLTRELG PVLAGLIVAG RVGASIAAEI       120
     ATMKVTEQVD ALYTLSTDPI KYLVCPRVIA AIITMPCLVL IGDVIGVMGG YLVGIYKLNF       180
     NSTAYLTSTF QYLELIDVIS GLVKATVFGF IISIISCYSG YYSGKGAKGV GRATTSAVVN       240
     SSILILISNY LITELLFKV                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page