(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE404

AE017197.PE404       Location/Qualifiers
FT   CDS             528597..529397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0417"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03894"
FT                   /db_xref="GOA:Q68WU8"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041205"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WU8"
FT                   /protein_id="AAU03894.1"
FT                   /translation="MKHIIGKILVIFVVIIGVLFVVKTIKTYSTNSIFVEVKQSEDAKK
FT                   CEEARIQEIIKDYLLKTPEIIIESIEGLQKRKIHENETKINNYLKANKSTIENSANFPV
FT                   IGNQNGDITIIAFYDYNCSFCKKGDISINELLQNDQKVKVVLRPLPILGDASEYLARIV
FT                   LAVYKVNPNKFKVIHDALIKIRTASQESIKELLIEHGLNSTEIEKIADSNEIKDLITQN
FT                   IKIARSLRMQGVPTYIIDSKLIHGLIDLPQLLNLVKEIMDNKFS"
     MKHIIGKILV IFVVIIGVLF VVKTIKTYST NSIFVEVKQS EDAKKCEEAR IQEIIKDYLL        60
     KTPEIIIESI EGLQKRKIHE NETKINNYLK ANKSTIENSA NFPVIGNQNG DITIIAFYDY       120
     NCSFCKKGDI SINELLQNDQ KVKVVLRPLP ILGDASEYLA RIVLAVYKVN PNKFKVIHDA       180
     LIKIRTASQE SIKELLIEHG LNSTEIEKIA DSNEIKDLIT QNIKIARSLR MQGVPTYIID       240
     SKLIHGLIDL PQLLNLVKEI MDNKFS                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page