(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE417

AE017197.PE417       Location/Qualifiers
FT   CDS             542365..543294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03907"
FT                   /db_xref="GOA:Q68WT5"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WT5"
FT                   /protein_id="AAU03907.1"
FT                   /translation="MIIFSIVFFKTVSVLLSVVIGFLAGRYSNVEKDSISSLLFYFISP
FT                   IVFFTIPASTTLTLSALSVTVVTFVIATLLSLFSYYFFGKFWQDHTRNIIALSAGTANG
FT                   GYFMLPIAAALFDDYTLSIYMMAVIGINIYECSVGFYICMRSFTNTTDSILKVVKLPIL
FT                   NAFFLGCLFSFCGFTLPDFLDDFIYNMKGSFSILGMVMVGLALSSLQKFEVDIKFTLAT
FT                   FAAKFLFYPLGVGLFIMFDHFVTKWYNNDYYNALKLLSTAPLAANTIVIANLQKFYPEK
FT                   VAATVFLSLLFVVIYMPTMVSIFLSDLN"
     MIIFSIVFFK TVSVLLSVVI GFLAGRYSNV EKDSISSLLF YFISPIVFFT IPASTTLTLS        60
     ALSVTVVTFV IATLLSLFSY YFFGKFWQDH TRNIIALSAG TANGGYFMLP IAAALFDDYT       120
     LSIYMMAVIG INIYECSVGF YICMRSFTNT TDSILKVVKL PILNAFFLGC LFSFCGFTLP       180
     DFLDDFIYNM KGSFSILGMV MVGLALSSLQ KFEVDIKFTL ATFAAKFLFY PLGVGLFIMF       240
     DHFVTKWYNN DYYNALKLLS TAPLAANTIV IANLQKFYPE KVAATVFLSL LFVVIYMPTM       300
     VSIFLSDLN                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page