(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE418

AE017197.PE418       Location/Qualifiers
FT   CDS             543352..544224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0431"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03908"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PDB:4OSE"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WT4"
FT                   /protein_id="AAU03908.1"
FT                   /translation="MQINSIKIGPYINLLPLQYIPQHKISYVEFGDPKNKNIILCAHGL
FT                   TRNAHDFDKIAKELCKNYRIISINYPGRSDSENLKKPYHYNYTTYIKDTLLFFKRLNIK
FT                   NPIWLGTSMGGIIGMVLASKYKNIFKALILNDIGAFIDAAPLIKIGDYAKKTVLLDDLA
FT                   SAKEHLKLIYAQIGIKNEEDWDYLTKYSVISTFGGKYKMNYDPAITKGMQSDNNQEDVK
FT                   LWSVWNKIKCRILVIHGMKSQILTKSTIQKMKKTNTFDLYEIKYAGHAPSLMNDEEIYY
FT                   IESWLKQKS"
     MQINSIKIGP YINLLPLQYI PQHKISYVEF GDPKNKNIIL CAHGLTRNAH DFDKIAKELC        60
     KNYRIISINY PGRSDSENLK KPYHYNYTTY IKDTLLFFKR LNIKNPIWLG TSMGGIIGMV       120
     LASKYKNIFK ALILNDIGAF IDAAPLIKIG DYAKKTVLLD DLASAKEHLK LIYAQIGIKN       180
     EEDWDYLTKY SVISTFGGKY KMNYDPAITK GMQSDNNQED VKLWSVWNKI KCRILVIHGM       240
     KSQILTKSTI QKMKKTNTFD LYEIKYAGHA PSLMNDEEIY YIESWLKQKS                  290
//

If you have problems or comments...

PBIL Back to PBIL home page