(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE42

AE017197.PE42        Location/Qualifiers
FT   CDS             complement(56335..57345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0045"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03532"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XW0"
FT                   /protein_id="AAU03532.1"
FT                   /translation="MVVLNKIKYIIKHYYLTIINIPHFIKNQIVEFRNYINDCKYKLSH
FT                   LAETNYQLGFDHLYKGNLNDALFRFKLVNKFFKSNDSKVYYQLGLIYYLKNNYRQATVY
FT                   LEKSNEKYKTIFINFFKNYKYITEIPQEIWEKYRDLIAQYYPTIFNNRKNIHLPYRFVN
FT                   ETLKHISDLSDNYSILELGSNIGLVGYEVQKRFPENFTLTGVEISSCMNDIQATYYQNT
FT                   KIYNHIYNIAIDEFLKQNSSKFDIILSFCGLSFTNNLIKYFNLIYSCLKQQGYFALCLP
FT                   NAVKTQFSVKRKEFIFNLNEVNNFLQKNNFTILTSDEIILAENNKYSIIVCKKIT"
     MVVLNKIKYI IKHYYLTIIN IPHFIKNQIV EFRNYINDCK YKLSHLAETN YQLGFDHLYK        60
     GNLNDALFRF KLVNKFFKSN DSKVYYQLGL IYYLKNNYRQ ATVYLEKSNE KYKTIFINFF       120
     KNYKYITEIP QEIWEKYRDL IAQYYPTIFN NRKNIHLPYR FVNETLKHIS DLSDNYSILE       180
     LGSNIGLVGY EVQKRFPENF TLTGVEISSC MNDIQATYYQ NTKIYNHIYN IAIDEFLKQN       240
     SSKFDIILSF CGLSFTNNLI KYFNLIYSCL KQQGYFALCL PNAVKTQFSV KRKEFIFNLN       300
     EVNNFLQKNN FTILTSDEII LAENNKYSII VCKKIT                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page