(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE422

AE017197.PE422       Location/Qualifiers
FT   CDS             join(550679..551433,551435..552044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="RT0435"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03912"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WT0"
FT                   /protein_id="AAU03912.1"
FT                   /translation="MSAIITNINDSIQKMKKNDEMTELSAAVQGKIIDIKNVDSRLDTL
FT                   NKNIVILDPIQQYLQSEEYITSTLEVLASNIISEVVENKDVQKLVDNLHINLGQVTKLM
FT                   PSAADKFKFDIARAEAALKGFVLPLNDGGNFDELSLMGIEDKEEIFAGPISATKKALIA
FT                   ISGNAIPKEQYANAVKDKAIEILQQDPKNTPEKLEKYEKFIIQGDKNQKFNKDSNQFIP
FT                   RVNKLSQVEFKALQNAATDTVHKISARLEKNNEISKQLEQIVLITNSSGIKKSEVIINK
FT                   LNKLDSTYLKENSTKIATALKDINNKGSSLWEKFKQIFTGKNYLEERLSKFVDKHITLS
FT                   DGYVVKTINDKIFSNALTNPEIAVGLTQFLNQNKDKVTTNPEFKNLIPVTGEHIIIQPQ
FT                   QVQNLNLAQLRKINPITFDRTIFEDSIKLRNSNIKYPQTTPHTATKNQEAVRSKG"
     MSAIITNIND SIQKMKKNDE MTELSAAVQG KIIDIKNVDS RLDTLNKNIV ILDPIQQYLQ        60
     SEEYITSTLE VLASNIISEV VENKDVQKLV DNLHINLGQV TKLMPSAADK FKFDIARAEA       120
     ALKGFVLPLN DGGNFDELSL MGIEDKEEIF AGPISATKKA LIAISGNAIP KEQYANAVKD       180
     KAIEILQQDP KNTPEKLEKY EKFIIQGDKN QKFNKDSNQF IPRVNKLSQV EFKALQNAAT       240
     DTVHKISARL EKNNEISKQL EQIVLITNSS GIKKSEVIIN KLNKLDSTYL KENSTKIATA       300
     LKDINNKGSS LWEKFKQIFT GKNYLEERLS KFVDKHITLS DGYVVKTIND KIFSNALTNP       360
     EIAVGLTQFL NQNKDKVTTN PEFKNLIPVT GEHIIIQPQQ VQNLNLAQLR KINPITFDRT       420
     IFEDSIKLRN SNIKYPQTTP HTATKNQEAV RSKG                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page