(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE428

AE017197.PE428       Location/Qualifiers
FT   CDS             complement(567565..568323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0442"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03918"
FT                   /db_xref="GOA:Q68WS4"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WS4"
FT                   /protein_id="AAU03918.1"
FT                   /translation="MSGHSKFKNIQHRKGAQDKKKSKVFTKLIREIVTAVKTGASNVPE
FT                   NNPRLRKALNAARSQNLPKERIDKAINSANDASNTESYTEIRYEGYAPNGIAIIIEALT
FT                   DNKNRTASEVRSSFTKYGGILGETGSVNYLFNHCGVIQYPINIASNEDIFEAAIEAGGN
FT                   DIISNDFAHTIYTDIENFYKALGFLTDKYGIPEDSYIGWIPVNTIIIDDKEKAKKLLKL
FT                   IEVLEENDDVQRVFGNYMLSEDVYEIIQEE"
     MSGHSKFKNI QHRKGAQDKK KSKVFTKLIR EIVTAVKTGA SNVPENNPRL RKALNAARSQ        60
     NLPKERIDKA INSANDASNT ESYTEIRYEG YAPNGIAIII EALTDNKNRT ASEVRSSFTK       120
     YGGILGETGS VNYLFNHCGV IQYPINIASN EDIFEAAIEA GGNDIISNDF AHTIYTDIEN       180
     FYKALGFLTD KYGIPEDSYI GWIPVNTIII DDKEKAKKLL KLIEVLEEND DVQRVFGNYM       240
     LSEDVYEIIQ EE                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page