(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE431

AE017197.PE431       Location/Qualifiers
FT   CDS             569537..570028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0445"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03921"
FT                   /db_xref="InterPro:IPR024386"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WS1"
FT                   /protein_id="AAU03921.1"
FT                   /translation="MNIKLVIYFLILVNSLKVNADLNHIQDSFEYQKEQLAIELPWSDC
FT                   TAIHKFLEEKLFFSEQQIKKENKIHEKYKQFYLQYNNKLSDFSMHFLDKNTEINGVETL
FT                   ISGFLKFCEDNFQTNKSKTNFLNFFQKQQDQWLHNIRNENYKTHYRKNMKIIPLEKLTN
FT                   "
     MNIKLVIYFL ILVNSLKVNA DLNHIQDSFE YQKEQLAIEL PWSDCTAIHK FLEEKLFFSE        60
     QQIKKENKIH EKYKQFYLQY NNKLSDFSMH FLDKNTEING VETLISGFLK FCEDNFQTNK       120
     SKTNFLNFFQ KQQDQWLHNI RNENYKTHYR KNMKIIPLEK LTN                         163
//

If you have problems or comments...

PBIL Back to PBIL home page