(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE432

AE017197.PE432       Location/Qualifiers
FT   CDS             571983..572663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0446"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03922"
FT                   /db_xref="GOA:Q68WS0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WS0"
FT                   /protein_id="AAU03922.1"
FT                   /translation="MIDKNFADILEISAKCGYLTNLLKNVYRSADIIVTDMSPLLLDSF
FT                   DHNNKLLIDDENLEFQKDSFDLIIYSLGLHWINDVQRFLYNIRTFLKSDGIFIGNFVGG
FT                   DSLKNLRKSLIDDEIASGFKHSPHISPFIRFDHVPMLLLHAGFSEVIVDYENIALKFEN
FT                   PLVLMREIKNIGESNALNSQHSYAISKKMFSLLKNYINVFEDNITLISFIAAPNKNSIR
FT                   LKLL"
     MIDKNFADIL EISAKCGYLT NLLKNVYRSA DIIVTDMSPL LLDSFDHNNK LLIDDENLEF        60
     QKDSFDLIIY SLGLHWINDV QRFLYNIRTF LKSDGIFIGN FVGGDSLKNL RKSLIDDEIA       120
     SGFKHSPHIS PFIRFDHVPM LLLHAGFSEV IVDYENIALK FENPLVLMRE IKNIGESNAL       180
     NSQHSYAISK KMFSLLKNYI NVFEDNITLI SFIAAPNKNS IRLKLL                      226
//

If you have problems or comments...

PBIL Back to PBIL home page