(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE438

AE017197.PE438       Location/Qualifiers
FT   CDS             578846..581596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0452"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:RT0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03928"
FT                   /db_xref="GOA:Q68WR4"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WR4"
FT                   /protein_id="AAU03928.1"
FT                   /translation="MPNIDLFILTSFLGINLLIGLLNIKNIKNNREYAVGERNFSTSAI
FT                   VATLIATWISTSIFLIDNSIIYQNGLFYLLPSIFGSIVSWLLMSYFIAPRCENILGSLS
FT                   VAEIIGAAYGNKVRILTAIVSILMSIGRIAMQFHVAGLILQLFFNISNFYINLCIATII
FT                   ISYSAFGGVKSVTFTKAVQFFTYSLIIPIIGIVIWNVLSDPYIVINSNVQNSLIDLQEL
FT                   FHCTSPKFWIALNIFIYFAIPSFSPSIFQSILIAKDTKQISRTFFISAVICLCWSIIFI
FT                   WITILLSQNSVIETNELFLRIIKSYIGFKGLIVGVVMAMIIASTNSYINVAAVTFTNDI
FT                   IKKTSLNYNYITAITIGLIGFIISLYTQDLINLFLLLTSIYFPLITLPLILLIYGFKST
FT                   TKSFFIGTIAAIFTIISWQIFSLRAVLGIYPMLPTTIVTLIFFLGRHYILKQPGGFSTL
FT                   KEPLSVKIIRQDRKRKFLTLFRAVKNFNIFKYWKSTLPNQEITYSYVGIFILISMFSSL
FT                   YTTSGSRIMNHLVIYNIIYHTTFIAAAILITYPLWSLKFKKKYIISFSWFIATFVILIF
FT                   FGSLLVILNDFDQLQLMYSVINSLIIATIFRWQATLLMTVTGVFASIEFYKYFIDEKLL
FT                   ISIDSFQFKVVYFLTLFSSLLIVFLKPRQDQEMLINLKNTHLGNRVNYREQELEKLLDL
FT                   KHEFLRNINHEINTPLTGIISLGETLWANYDKFNEDQRRNAVEIIAKSSIRLNSLINNI
FT                   LDFSKLSSLNYELNKNYINLSELLHERIKICKKLYLNGKILNFVSDIEENIIFNCDPHY
FT                   IQHTFDNLIINAISYSSEGTIKIDLQKQTDSILFMIKDDGIGVPKEELPNIFGVFVVSS
FT                   KTRTQAGGRGVGLALCKKVIELHSGKIWAENDKQGKTHFIVTMPL"
     MPNIDLFILT SFLGINLLIG LLNIKNIKNN REYAVGERNF STSAIVATLI ATWISTSIFL        60
     IDNSIIYQNG LFYLLPSIFG SIVSWLLMSY FIAPRCENIL GSLSVAEIIG AAYGNKVRIL       120
     TAIVSILMSI GRIAMQFHVA GLILQLFFNI SNFYINLCIA TIIISYSAFG GVKSVTFTKA       180
     VQFFTYSLII PIIGIVIWNV LSDPYIVINS NVQNSLIDLQ ELFHCTSPKF WIALNIFIYF       240
     AIPSFSPSIF QSILIAKDTK QISRTFFISA VICLCWSIIF IWITILLSQN SVIETNELFL       300
     RIIKSYIGFK GLIVGVVMAM IIASTNSYIN VAAVTFTNDI IKKTSLNYNY ITAITIGLIG       360
     FIISLYTQDL INLFLLLTSI YFPLITLPLI LLIYGFKSTT KSFFIGTIAA IFTIISWQIF       420
     SLRAVLGIYP MLPTTIVTLI FFLGRHYILK QPGGFSTLKE PLSVKIIRQD RKRKFLTLFR       480
     AVKNFNIFKY WKSTLPNQEI TYSYVGIFIL ISMFSSLYTT SGSRIMNHLV IYNIIYHTTF       540
     IAAAILITYP LWSLKFKKKY IISFSWFIAT FVILIFFGSL LVILNDFDQL QLMYSVINSL       600
     IIATIFRWQA TLLMTVTGVF ASIEFYKYFI DEKLLISIDS FQFKVVYFLT LFSSLLIVFL       660
     KPRQDQEMLI NLKNTHLGNR VNYREQELEK LLDLKHEFLR NINHEINTPL TGIISLGETL       720
     WANYDKFNED QRRNAVEIIA KSSIRLNSLI NNILDFSKLS SLNYELNKNY INLSELLHER       780
     IKICKKLYLN GKILNFVSDI EENIIFNCDP HYIQHTFDNL IINAISYSSE GTIKIDLQKQ       840
     TDSILFMIKD DGIGVPKEEL PNIFGVFVVS SKTRTQAGGR GVGLALCKKV IELHSGKIWA       900
     ENDKQGKTHF IVTMPL                                                       916
//

If you have problems or comments...

PBIL Back to PBIL home page