(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE44

AE017197.PE44        Location/Qualifiers
FT   CDS             58889..59545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0047"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03534"
FT                   /db_xref="GOA:Q68XV8"
FT                   /db_xref="InterPro:IPR007172"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XV8"
FT                   /protein_id="AAU03534.1"
FT                   /translation="MRKALKKFLKNSKCLLSIITILLYWYLRFVYFTSRQKFIFYDNRN
FT                   KEKFLNEQGVIFAFWHNMLALSPVMFTGHRNIYALISPHLDGKILNAIVGKFGCQVIVG
FT                   STNKNSIVALRNIIGKLSQGANIIVTPDGPKGPVYKVNSGITEIAYRYNKKLIPIVSST
FT                   SRYFRLKSWDKLIIPIPFGTIKIIVGSPLALVADKVKNHINLEKQLKSLTESLKK"
     MRKALKKFLK NSKCLLSIIT ILLYWYLRFV YFTSRQKFIF YDNRNKEKFL NEQGVIFAFW        60
     HNMLALSPVM FTGHRNIYAL ISPHLDGKIL NAIVGKFGCQ VIVGSTNKNS IVALRNIIGK       120
     LSQGANIIVT PDGPKGPVYK VNSGITEIAY RYNKKLIPIV SSTSRYFRLK SWDKLIIPIP       180
     FGTIKIIVGS PLALVADKVK NHINLEKQLK SLTESLKK                               218
//

If you have problems or comments...

PBIL Back to PBIL home page