(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE442

AE017197.PE442       Location/Qualifiers
FT   CDS             586848..587288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0457"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03932"
FT                   /db_xref="InterPro:IPR019291"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WR0"
FT                   /protein_id="AAU03932.1"
FT                   /translation="MVGTALLKLIAVIDSKHMMLYDALGIKITTNKPLKLTLDLEEHHH
FT                   HREKRQSFYQNKSTPGALFEPHTSLKDIEHKEAARSVIKHLEKITTANQTKYKELIIIA
FT                   EPQMLGYIRQKLTSGLKKIVTKEIAKDLVQHNVGAVERAVFA"
     MVGTALLKLI AVIDSKHMML YDALGIKITT NKPLKLTLDL EEHHHHREKR QSFYQNKSTP        60
     GALFEPHTSL KDIEHKEAAR SVIKHLEKIT TANQTKYKEL IIIAEPQMLG YIRQKLTSGL       120
     KKIVTKEIAK DLVQHNVGAV ERAVFA                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page