(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE444

AE017197.PE444       Location/Qualifiers
FT   CDS             complement(588509..589513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0459"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03934"
FT                   /db_xref="GOA:Q68WQ8"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WQ8"
FT                   /protein_id="AAU03934.1"
FT                   /translation="MFRLLLISITFLVLYSGFTFIEHFNSKVVISLYNYNIETTLFLSV
FT                   ILELLLLVFCFIIIRFLIIIIDLPATIHNIFSKRKINHDRHALILAFAEYIIGNKMKAA
FT                   SIARKNLSSDDLKDFQKFYNFILAITADDIDSKIFYFQKLITSKEFIFYASKNLAKLYY
FT                   DKSLYDKAENYAIKAYNLNKLDSDNLIILMHCYAKLSLWTKFIFITNKLAKFHKHEFIP
FT                   KITQYYLLIAKQEVNSNNTANAIDYLEKAIDLNFYNDELLEFYFNLNDKLSVDQKTKIL
FT                   KKAFRITPSLRLVQLFKKITSLSDKQIYEELIQVLDTKKDKIFILAIESYLEL"
     MFRLLLISIT FLVLYSGFTF IEHFNSKVVI SLYNYNIETT LFLSVILELL LLVFCFIIIR        60
     FLIIIIDLPA TIHNIFSKRK INHDRHALIL AFAEYIIGNK MKAASIARKN LSSDDLKDFQ       120
     KFYNFILAIT ADDIDSKIFY FQKLITSKEF IFYASKNLAK LYYDKSLYDK AENYAIKAYN       180
     LNKLDSDNLI ILMHCYAKLS LWTKFIFITN KLAKFHKHEF IPKITQYYLL IAKQEVNSNN       240
     TANAIDYLEK AIDLNFYNDE LLEFYFNLND KLSVDQKTKI LKKAFRITPS LRLVQLFKKI       300
     TSLSDKQIYE ELIQVLDTKK DKIFILAIES YLEL                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page