(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE445

AE017197.PE445       Location/Qualifiers
FT   CDS             complement(589506..590186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0460"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03935"
FT                   /db_xref="GOA:Q68WQ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WQ7"
FT                   /protein_id="AAU03935.1"
FT                   /translation="MQKFDSLFKSRNIFFIAIVIFILSSVILYHNRSDILKLFKIENKD
FT                   LNQITAQEIENKENAILEKKEYETILSTKSFLNYVNFLKSSKTSILNSEGDSVEAPIKL
FT                   NSVNYTDYLLNVNLLVYNFTQDKDYSKELRILKSYPLPQNIRNILNNLEKYNNNYLVSK
FT                   LSSTVVIFPTQHKWLEQLIKIEKKSSAIIAKEQDKTLILEKLNYLIYFLYSEKFMQEFV
FT                   NKDV"
     MQKFDSLFKS RNIFFIAIVI FILSSVILYH NRSDILKLFK IENKDLNQIT AQEIENKENA        60
     ILEKKEYETI LSTKSFLNYV NFLKSSKTSI LNSEGDSVEA PIKLNSVNYT DYLLNVNLLV       120
     YNFTQDKDYS KELRILKSYP LPQNIRNILN NLEKYNNNYL VSKLSSTVVI FPTQHKWLEQ       180
     LIKIEKKSSA IIAKEQDKTL ILEKLNYLIY FLYSEKFMQE FVNKDV                      226
//

If you have problems or comments...

PBIL Back to PBIL home page