(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE446

AE017197.PE446       Location/Qualifiers
FT   CDS             complement(590170..590985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0461"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03936"
FT                   /db_xref="GOA:Q68WQ6"
FT                   /db_xref="InterPro:IPR005728"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WQ6"
FT                   /protein_id="AAU03936.1"
FT                   /translation="MKSVLLTRNIQENKETIQEISKYNLDLRYIHCALIKYQTLDFNIN
FT                   ILNNYSNIIITSKYAASILADYNLQQDIWVVGSKTKQLLGKKVMYTAKNIADLIQHFPT
FT                   DLYKHTIYLSSNEITKDLPHKIARHIIYNVEYLNELPISIIQEFEKNIRFFSKVAYRNE
FT                   FKENITRDTTSYKKVDDDHSLGPTYPLEEQLGKMSIDFILLYSQNSAKTLVRLLLQNNL
FT                   LQYLQDSLVIAISLKVANIVRPFIKNVVYCDNQNSNDIIKLLYENAKIR"
     MKSVLLTRNI QENKETIQEI SKYNLDLRYI HCALIKYQTL DFNINILNNY SNIIITSKYA        60
     ASILADYNLQ QDIWVVGSKT KQLLGKKVMY TAKNIADLIQ HFPTDLYKHT IYLSSNEITK       120
     DLPHKIARHI IYNVEYLNEL PISIIQEFEK NIRFFSKVAY RNEFKENITR DTTSYKKVDD       180
     DHSLGPTYPL EEQLGKMSID FILLYSQNSA KTLVRLLLQN NLLQYLQDSL VIAISLKVAN       240
     IVRPFIKNVV YCDNQNSNDI IKLLYENAKI R                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page