(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE462

AE017197.PE462       Location/Qualifiers
FT   CDS             614027..614167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03952"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WP0"
FT                   /protein_id="AAU03952.1"
FT                   /translation="MYHILSLEVFVALDLHKLANCTASLQDVKNIKDQFKYAIRPKFKL
FT                   F"
     MYHILSLEVF VALDLHKLAN CTASLQDVKN IKDQFKYAIR PKFKLF                       46
//

If you have problems or comments...

PBIL Back to PBIL home page