(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE472

AE017197.PE472       Location/Qualifiers
FT   CDS             626956..627915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0490"
FT                   /product="sugar isomerase protein KpsF/GutQ family"
FT                   /db_xref="EnsemblGenomes-Gn:RT0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03962"
FT                   /db_xref="GOA:Q68WN0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WN0"
FT                   /protein_id="AAU03962.1"
FT                   /translation="MINTNNYHIIAKRIISNAANALDKLSNNIPADFNRIIEFLLSFKG
FT                   RIILTGIGKSGYIARKIAASFSSTGMPSFYLHPSEASHGDLGTITRNDLVMMLSNSGET
FT                   KELFNIIEYCNNSSIKIAAMTMNKNSTLAKRSDFLLIIPECQEASLIGAPTISSLIMLS
FT                   LGDAVMTVIHEERGFTRDDFKIYHPGGTIGANLTKIKNIMRSGDEIPLVYEDTSFTETI
FT                   IIMNKKRLGCTLVTDKEQNLIGIITDGDLRRNINDQIHLKTASSIMTKNPHHISSGIFA
FT                   QEALNLMKAKNITNIPIVDNNMIIGIIHIHDLLRMGVS"
     MINTNNYHII AKRIISNAAN ALDKLSNNIP ADFNRIIEFL LSFKGRIILT GIGKSGYIAR        60
     KIAASFSSTG MPSFYLHPSE ASHGDLGTIT RNDLVMMLSN SGETKELFNI IEYCNNSSIK       120
     IAAMTMNKNS TLAKRSDFLL IIPECQEASL IGAPTISSLI MLSLGDAVMT VIHEERGFTR       180
     DDFKIYHPGG TIGANLTKIK NIMRSGDEIP LVYEDTSFTE TIIIMNKKRL GCTLVTDKEQ       240
     NLIGIITDGD LRRNINDQIH LKTASSIMTK NPHHISSGIF AQEALNLMKA KNITNIPIVD       300
     NNMIIGIIHI HDLLRMGVS                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page