(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE473

AE017197.PE473       Location/Qualifiers
FT   CDS             627922..628527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0491"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03963"
FT                   /db_xref="GOA:Q68WM9"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WM9"
FT                   /protein_id="AAU03963.1"
FT                   /translation="MPYFYKLRKKIWKSVYLLIILGMLYIGYILIQNGYMNEKNDINVT
FT                   KKNLNLRNNKNYDLKYNVILQDSIFEGVNKNLNAYKIKTERAIKESGNKYKLDIINAIY
FT                   SIKQDQTLIITAKEGFLDQESNTLDLKNDIKLFVDEIIFNTNNARINLVNQNINGNSSA
FT                   KLIYKNSSITSDSFNTMNENNIIIFKGNVSTIIDLSDY"
     MPYFYKLRKK IWKSVYLLII LGMLYIGYIL IQNGYMNEKN DINVTKKNLN LRNNKNYDLK        60
     YNVILQDSIF EGVNKNLNAY KIKTERAIKE SGNKYKLDII NAIYSIKQDQ TLIITAKEGF       120
     LDQESNTLDL KNDIKLFVDE IIFNTNNARI NLVNQNINGN SSAKLIYKNS SITSDSFNTM       180
     NENNIIIFKG NVSTIIDLSD Y                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page