(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE478

AE017197.PE478       Location/Qualifiers
FT   CDS             complement(633560..636421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0496"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03968"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WM4"
FT                   /protein_id="AAU03968.1"
FT                   /translation="MAATNNKNYQKVVEKVLSSSKANKALKSAIKDLSSSNSISLRTIL
FT                   LGAKFILTHPVNTYNLVKLAKSSNIYLGSEFQKSLLENSPIWEFLKKHSDDLPKIGRIL
FT                   AKAGFREFQDKSALDEEGLKILKECFKNEKVLNKLQDIAVELKQELTDWNKVTSNILDM
FT                   LVTDKNFQKFFNAKSKDITHYIRTGVTEILPSDYIKSFDDILQKPEKKKLLKIFNTHPD
FT                   VKQELVNNINNPNILKKFNKLFYEQEIILSSFLKEVKAQSKPFLQEYFESYKIDLKILD
FT                   IIPTLLNKIPEIKEIFDTLNDPNQGVMISLEKALAMVAGDDQLKNFFANNKTILPNIAL
FT                   GIIENTPSVQNITKEYNFDKQMLIIVGEVMSKPEIAYEIITDLNKGDYMSLTGNIISII
FT                   NDPSFKLKDILVEQSKKGLFDNLINGVLAQDEKNSQIIKQQLINYGMEASDVTKLTRIM
FT                   PILLDKPESLKNVFRDFIKGNYTQMTKELIVLTKDNPEIKEYLNNNRTIFANILDKTLS
FT                   DIPGINNLDKQELYNVLPSMLNYPGELVKIIEEVEKSNYHGAISAIYDLAQKTNYFEGQ
FT                   LPNIIKAGFNSGFNYATEKVKDIFSSSQDFKDKAIDEITIRTNLDKIRNRKFNLEGAIL
FT                   SGNLSNIDFSGVSLKNADLTQVTSLRDCNFKNTNLVDAKLPDNLIIFTDTYNLDKTIPT
FT                   LAPKLIKAQQAKLVDKAIDKVFVQIKAEDKRNLVSKKEFVQQVKILLEENQIVKDYIID
FT                   KLNSLPMNMVTNLETPKINQYKHITNHVNSPFQILNPLYENIANQQDIKSNLFANILSE
FT                   KISKKLFDKGDNRGEDFYLINQMLKSIVAEYSKPNQNNIDNFLEHQNLEKLASNIASTF
FT                   YSKSKYTLLGTITSGIYLPKEIFNEQLKDNLKNEFKKINTSDVLKEAKSIVSNLDSKVH
FT                   IVDNKNKSHTYKSVLTKNQKIHR"
     MAATNNKNYQ KVVEKVLSSS KANKALKSAI KDLSSSNSIS LRTILLGAKF ILTHPVNTYN        60
     LVKLAKSSNI YLGSEFQKSL LENSPIWEFL KKHSDDLPKI GRILAKAGFR EFQDKSALDE       120
     EGLKILKECF KNEKVLNKLQ DIAVELKQEL TDWNKVTSNI LDMLVTDKNF QKFFNAKSKD       180
     ITHYIRTGVT EILPSDYIKS FDDILQKPEK KKLLKIFNTH PDVKQELVNN INNPNILKKF       240
     NKLFYEQEII LSSFLKEVKA QSKPFLQEYF ESYKIDLKIL DIIPTLLNKI PEIKEIFDTL       300
     NDPNQGVMIS LEKALAMVAG DDQLKNFFAN NKTILPNIAL GIIENTPSVQ NITKEYNFDK       360
     QMLIIVGEVM SKPEIAYEII TDLNKGDYMS LTGNIISIIN DPSFKLKDIL VEQSKKGLFD       420
     NLINGVLAQD EKNSQIIKQQ LINYGMEASD VTKLTRIMPI LLDKPESLKN VFRDFIKGNY       480
     TQMTKELIVL TKDNPEIKEY LNNNRTIFAN ILDKTLSDIP GINNLDKQEL YNVLPSMLNY       540
     PGELVKIIEE VEKSNYHGAI SAIYDLAQKT NYFEGQLPNI IKAGFNSGFN YATEKVKDIF       600
     SSSQDFKDKA IDEITIRTNL DKIRNRKFNL EGAILSGNLS NIDFSGVSLK NADLTQVTSL       660
     RDCNFKNTNL VDAKLPDNLI IFTDTYNLDK TIPTLAPKLI KAQQAKLVDK AIDKVFVQIK       720
     AEDKRNLVSK KEFVQQVKIL LEENQIVKDY IIDKLNSLPM NMVTNLETPK INQYKHITNH       780
     VNSPFQILNP LYENIANQQD IKSNLFANIL SEKISKKLFD KGDNRGEDFY LINQMLKSIV       840
     AEYSKPNQNN IDNFLEHQNL EKLASNIAST FYSKSKYTLL GTITSGIYLP KEIFNEQLKD       900
     NLKNEFKKIN TSDVLKEAKS IVSNLDSKVH IVDNKNKSHT YKSVLTKNQK IHR              953
//

If you have problems or comments...

PBIL Back to PBIL home page