(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE484

AE017197.PE484       Location/Qualifiers
FT   CDS             complement(643047..643604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0502"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03974"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WL8"
FT                   /protein_id="AAU03974.1"
FT                   /translation="MLIIPYKGIIPKIAKSAYIAKNSSLIGDVVIGNNSSIWFNTVLRG
FT                   DVESIKIGNNTNVQDGSVIHTSRFNGPVEIGNNITIGHLSLIHACTIHNNAFIGMSTTI
FT                   MDNAVIEEYAFIAAGSLVPSKKIIKSNELWMGSPAKFIRYLTDQDLQYMEDNIRNYVEL
FT                   ANLYKTQSQCTLHSINNCKKLS"
     MLIIPYKGII PKIAKSAYIA KNSSLIGDVV IGNNSSIWFN TVLRGDVESI KIGNNTNVQD        60
     GSVIHTSRFN GPVEIGNNIT IGHLSLIHAC TIHNNAFIGM STTIMDNAVI EEYAFIAAGS       120
     LVPSKKIIKS NELWMGSPAK FIRYLTDQDL QYMEDNIRNY VELANLYKTQ SQCTLHSINN       180
     CKKLS                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page