(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE5

AE017197.PE5         Location/Qualifiers
FT   CDS             2840..5896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0005"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03495"
FT                   /db_xref="GOA:Q68XZ7"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XZ7"
FT                   /protein_id="AAU03495.1"
FT                   /translation="MKLGFNLDFNELDLTGLKKLDQIFLDYLFKADKSLHKDLMLFRAT
FT                   PFSIIPQDYSKFLLKISPHLDDFLAELFCISKEVTISRLKHKDFDIIYECKRKFIQRVA
FT                   VKKYPLEKIKDIDFEDVYLKITNLIGTNFTSREFAKQIVIWQQDEESFSLELDIAARYA
FT                   AYRVFSCYNSLSSWNKNLFLQNDILFNFQQKLDKTNLIDDKKILKYQKNERLDFDYKDS
FT                   FLNLDEALNNSHYCIYCHKQDKDSCSKGFGVIPHFDRVISVDSLEYKIPWLRYSMTTGC
FT                   PLKQKISEMNYIKAQGFNLAALAIIVIDNPMVAATGNRICNDCSKACIYQKKQDPVNIP
FT                   LIESNILEETLKLPYGLEIYILLTRWNPLNIYAPLPKEPTNYNILVTGLGPAGFSLSYY
FT                   LLRSGHNVTAIDGLKITPLSFNIHKPIKFWHEYKNLLSERIPKGFGGVSEYGITIRWDK
FT                   NNLDILRLILERNNNFKYYDGVALGFNITKEQALDLNFDHVAFCIGAGKPKVLNIENFE
FT                   AKGVKTASDFLMTLQSGGAFLKNSNTNMVIRMPIVIIGGGLTSLDAATESLFYYKKQVE
FT                   EFAKNYIKQDLTEEDQEIAEEFIAHAKLFKEAKNNEELKKVFNKLGGATVYYRGRLQDS
FT                   PAYKLNYEELIYTLALGVDFKENMQPLRINIDKYGHVESVEFSVTTWFDSRTHNIYHSN
FT                   MRPTVKPSGNTALIKTKTVIMAIGIENNTQFDDDKYSYFGDCNPKYFGSVVKAITSAKE
FT                   GYEAINTRLINNVPSFKGSYAYFITQLDYLLTSRINKINILNDKTFEIIIHSPLAAKNF
FT                   KFGQFFRLQNYSKDITKLIEPIALSPVDIDIEKGLISFIVYAVGKSTRLCKTLSENEKV
FT                   VLMGPTGSPLKIPKNKKIIIIDSKYRNVGLLKILKENKNKVIFATYPDIKNHKLTSVDI
FT                   VIINTSPEIAEELQKLKIFGKNTELIVNVNSSMQCMMKGICGQCVQKVKGKQKYIFACS
FT                   GQNQNAEIIDFKSLKARLRQNSLQEKMSN"
     MKLGFNLDFN ELDLTGLKKL DQIFLDYLFK ADKSLHKDLM LFRATPFSII PQDYSKFLLK        60
     ISPHLDDFLA ELFCISKEVT ISRLKHKDFD IIYECKRKFI QRVAVKKYPL EKIKDIDFED       120
     VYLKITNLIG TNFTSREFAK QIVIWQQDEE SFSLELDIAA RYAAYRVFSC YNSLSSWNKN       180
     LFLQNDILFN FQQKLDKTNL IDDKKILKYQ KNERLDFDYK DSFLNLDEAL NNSHYCIYCH       240
     KQDKDSCSKG FGVIPHFDRV ISVDSLEYKI PWLRYSMTTG CPLKQKISEM NYIKAQGFNL       300
     AALAIIVIDN PMVAATGNRI CNDCSKACIY QKKQDPVNIP LIESNILEET LKLPYGLEIY       360
     ILLTRWNPLN IYAPLPKEPT NYNILVTGLG PAGFSLSYYL LRSGHNVTAI DGLKITPLSF       420
     NIHKPIKFWH EYKNLLSERI PKGFGGVSEY GITIRWDKNN LDILRLILER NNNFKYYDGV       480
     ALGFNITKEQ ALDLNFDHVA FCIGAGKPKV LNIENFEAKG VKTASDFLMT LQSGGAFLKN       540
     SNTNMVIRMP IVIIGGGLTS LDAATESLFY YKKQVEEFAK NYIKQDLTEE DQEIAEEFIA       600
     HAKLFKEAKN NEELKKVFNK LGGATVYYRG RLQDSPAYKL NYEELIYTLA LGVDFKENMQ       660
     PLRINIDKYG HVESVEFSVT TWFDSRTHNI YHSNMRPTVK PSGNTALIKT KTVIMAIGIE       720
     NNTQFDDDKY SYFGDCNPKY FGSVVKAITS AKEGYEAINT RLINNVPSFK GSYAYFITQL       780
     DYLLTSRINK INILNDKTFE IIIHSPLAAK NFKFGQFFRL QNYSKDITKL IEPIALSPVD       840
     IDIEKGLISF IVYAVGKSTR LCKTLSENEK VVLMGPTGSP LKIPKNKKII IIDSKYRNVG       900
     LLKILKENKN KVIFATYPDI KNHKLTSVDI VIINTSPEIA EELQKLKIFG KNTELIVNVN       960
     SSMQCMMKGI CGQCVQKVKG KQKYIFACSG QNQNAEIIDF KSLKARLRQN SLQEKMSN        1018
//

If you have problems or comments...

PBIL Back to PBIL home page