(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE506

AE017197.PE506       Location/Qualifiers
FT   CDS             complement(671001..672536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0527"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03996"
FT                   /db_xref="InterPro:IPR040519"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WJ6"
FT                   /protein_id="AAU03996.1"
FT                   /translation="MIQNKKSVFKGWNFLKPKLGGMNEAGEYGGVYQSSDGKITALIKK
FT                   ERSSSKNIAEFLGSQIFEAISPGNGAKVNLIAPDDFNKSKSVDSQIYVKSEFFENYSSD
FT                   MYIDMDKYMSAKTKPSSWFRKDGGRPLFMGSRNKLFRTLENAFKEIKYQNFEKIMPASL
FT                   LIGDFDVHLGNIGVIRNKKKPKTLPHLVRIDFGGSFDNLTDNIYPHSRIRHLPGFGPTN
FT                   HFREFPSSLRTKNPHFADSLLAASKIDLSKIIDQSFDKLTKYYSNEAITKFAQRAMPKK
FT                   FNNKSHEITIEEIKASLIDIMKKRQVSLKEYGLEIKINTLISKKYRFPYYEVKKQELKT
FT                   LIKEYPDYFAKILNYTKSKNGSLKLKFRDKLTTNFVRILKKFCIRNSVKKHLIKTIESL
FT                   NEDIKYESNLANSSDKRKNASKTVKTDRYGKSEYVDSLAKFYQAGGMDDIVCVTPSKLG
FT                   LISKAKQQDQDLLKLDVEDLKQIKNLKEKLMTPIKITESSVILNKKPTLTKIR"
     MIQNKKSVFK GWNFLKPKLG GMNEAGEYGG VYQSSDGKIT ALIKKERSSS KNIAEFLGSQ        60
     IFEAISPGNG AKVNLIAPDD FNKSKSVDSQ IYVKSEFFEN YSSDMYIDMD KYMSAKTKPS       120
     SWFRKDGGRP LFMGSRNKLF RTLENAFKEI KYQNFEKIMP ASLLIGDFDV HLGNIGVIRN       180
     KKKPKTLPHL VRIDFGGSFD NLTDNIYPHS RIRHLPGFGP TNHFREFPSS LRTKNPHFAD       240
     SLLAASKIDL SKIIDQSFDK LTKYYSNEAI TKFAQRAMPK KFNNKSHEIT IEEIKASLID       300
     IMKKRQVSLK EYGLEIKINT LISKKYRFPY YEVKKQELKT LIKEYPDYFA KILNYTKSKN       360
     GSLKLKFRDK LTTNFVRILK KFCIRNSVKK HLIKTIESLN EDIKYESNLA NSSDKRKNAS       420
     KTVKTDRYGK SEYVDSLAKF YQAGGMDDIV CVTPSKLGLI SKAKQQDQDL LKLDVEDLKQ       480
     IKNLKEKLMT PIKITESSVI LNKKPTLTKI R                                      511
//

If you have problems or comments...

PBIL Back to PBIL home page