(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE515

AE017197.PE515       Location/Qualifiers
FT   CDS             684741..685451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0536"
FT                   /product="possible RecO-like recombinational DNA repair
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04005"
FT                   /db_xref="GOA:Q68WI7"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WI7"
FT                   /protein_id="AAU04005.1"
FT                   /translation="MNIKDIGVIISKKPLKENTFIIRVFTKNHGLYSGVIKASSKKNKF
FT                   IYQEGNIVDFLWQARLHEHIGIAKCELIKSYTGYFIINKAKLYAFNSVKFLIQELFHER
FT                   EEHSIFFAFLINYLDNLSKNFCFRDYINFELNLLAETGYKIDLTKCCVSHVTTDLTYVS
FT                   PKSARALSYKVGKPYRDKLLILPKFLLSEDSKITLEEKKQALTLTNYFFNRYLFHNNRQ
FT                   VEARKEFIEYITNI"
     MNIKDIGVII SKKPLKENTF IIRVFTKNHG LYSGVIKASS KKNKFIYQEG NIVDFLWQAR        60
     LHEHIGIAKC ELIKSYTGYF IINKAKLYAF NSVKFLIQEL FHEREEHSIF FAFLINYLDN       120
     LSKNFCFRDY INFELNLLAE TGYKIDLTKC CVSHVTTDLT YVSPKSARAL SYKVGKPYRD       180
     KLLILPKFLL SEDSKITLEE KKQALTLTNY FFNRYLFHNN RQVEARKEFI EYITNI           236
//

If you have problems or comments...

PBIL Back to PBIL home page