(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE516

AE017197.PE516       Location/Qualifiers
FT   CDS             686003..686680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0537"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04006"
FT                   /db_xref="GOA:Q68WI6"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WI6"
FT                   /protein_id="AAU04006.1"
FT                   /translation="MKILAFDTANNTTSVAISENDNILKYIEALGPAMQAENLMPMIED
FT                   VMQSAQFSYDDLDYLAVTNGPGSFTGIRIGLASAKGILFAKKNIKAVVVSNFEYAYFRA
FT                   ITQVKNYDKIYVFLNAYRLQLYMQVFHKSGKREEPLLINYEYAIKCLTKEQGNIVCCGS
FT                   GLEFIYHKIMYLSHIITLPRFTRVKAWVICKYITTMLPRNIKLNNSIAPLYIRPPDAKR
FT                   TID"
     MKILAFDTAN NTTSVAISEN DNILKYIEAL GPAMQAENLM PMIEDVMQSA QFSYDDLDYL        60
     AVTNGPGSFT GIRIGLASAK GILFAKKNIK AVVVSNFEYA YFRAITQVKN YDKIYVFLNA       120
     YRLQLYMQVF HKSGKREEPL LINYEYAIKC LTKEQGNIVC CGSGLEFIYH KIMYLSHIIT       180
     LPRFTRVKAW VICKYITTML PRNIKLNNSI APLYIRPPDA KRTID                       225
//

If you have problems or comments...

PBIL Back to PBIL home page