(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE52

AE017197.PE52        Location/Qualifiers
FT   CDS             complement(74987..75871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0056"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03542"
FT                   /db_xref="GOA:Q68XV0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XV0"
FT                   /protein_id="AAU03542.1"
FT                   /translation="MNDALKTYLKGICWFLLSLVTSSVNDVISKYLGTRLHSFEVAFFR
FT                   FLFSSIVLLPFVVYYGKSTLKTRHPVIHVLRGLLLFFGMTSWTYGLTIAPVTTATVISF
FT                   SIPLFTLILAVFILNENIIWQRWVVTVVGFIGLVVMLKPHTKDFNPEILYLILAAISFA
FT                   MLDIINKKFVVKESMLSMLFYSAIVTAIVSLPVSMEYWITPSSFELTLLFVLGSSGSFI
FT                   LFFLLKAFTMVDATATAPYRYLELVISAIAAYFIFNEFPDKSTAHGAVIIIPATLFIMY
FT                   SEKKSMSSKHESQ"
     MNDALKTYLK GICWFLLSLV TSSVNDVISK YLGTRLHSFE VAFFRFLFSS IVLLPFVVYY        60
     GKSTLKTRHP VIHVLRGLLL FFGMTSWTYG LTIAPVTTAT VISFSIPLFT LILAVFILNE       120
     NIIWQRWVVT VVGFIGLVVM LKPHTKDFNP EILYLILAAI SFAMLDIINK KFVVKESMLS       180
     MLFYSAIVTA IVSLPVSMEY WITPSSFELT LLFVLGSSGS FILFFLLKAF TMVDATATAP       240
     YRYLELVISA IAAYFIFNEF PDKSTAHGAV IIIPATLFIM YSEKKSMSSK HESQ             294
//

If you have problems or comments...

PBIL Back to PBIL home page