(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE524

AE017197.PE524       Location/Qualifiers
FT   CDS             699459..705140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0546"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04014"
FT                   /db_xref="GOA:Q68WH8"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR021868"
FT                   /db_xref="InterPro:IPR041203"
FT                   /db_xref="InterPro:IPR041246"
FT                   /db_xref="InterPro:IPR041462"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WH8"
FT                   /protein_id="AAU04014.1"
FT                   /translation="MKNICCKCVLTIFLYLINLQVIATSFNEKIPVYLKLTNEKMLAGK
FT                   NSLNIDLCDSRIKEWCAKPQREMGLNRQKINEYISISPDIKGEWRFGWNYNINFIPEEN
FT                   FLPNQTYKITIKDSIFPNFISLKKNNISFTSLPLLSMIKEMNYLQDNINISQKFVQTKI
FT                   AFNYPIDPKSLEERIEFIKSSTKEKLSFSIKFNTDKTEAISITNIPPLTDKKDIVSIII
FT                   KDGVKILYGDEIFTQKNVDIQNNKMMQNNIRYSYKENVLIPSLSSYLKITNSTATIVKD
FT                   DKLKPEQIIIITTNTPVSGEEVKKHLELFLLPKNKPHFLGVAGKKNYKWQSPREITDDI
FT                   LKLSEKINFELLPAVPKITNVHHFKVDTLASRTVLIKIKKGVRTLDNLTLGSDYTQIIQ
FT                   IPDNPKEVKFMSDGSILSLSGKKKLPVYSLGIDKLYVEIDKIHQQEINHLISQTNRYNI
FT                   FQNPTFINEYSFNEYNISDVFQEEVIVNSQNLNLPHYTDLDFSKYLHLEQAGRYSKGLF
FT                   LAKVYSKDNNNNIISQDKRLILVTDLGFIVKTDKTGTHHIFVSYISNGKPAEGVKADII
FT                   GLNGEILVSSKTDSQGHTVLSNIRDLNKGKIPIAYVLTTKDDFSFMPYNRVDQQVNYSR
FT                   FDISGTVNSEEGLKAYLFSDRGIYRPSEQGHIGIMLKQNDWHGKFDGLPLGIQVTNPYG
FT                   RVIDKNKIVLNSEGLGEYLFTTFDDSLTGLYNISLYLGEPGINNYLNSVSVRVGDFQPD
FT                   RMKININFNNSKDTLWTHPKDLKATVKLINLYGIPAENRKVRGLIDIRPTEFFVANFKE
FT                   YTFYRSKDNKEFFNEHLGDVTTDSTGTANFDLNLDKYYNATFNLTFSAEGFEPDSGRSV
FT                   QGSKSLIVSPLPYIIGFRSNSNLKYIKKQVISTIEFIAISNKAKKVSAHNLTLKLNKIN
FT                   YVNNLVSDSNGNYSYSAVPVETNISSDNVNITENEGYIYNVPTNEEGDYVIYLTDTENR
FT                   IFAQTEFSVIGEGNVTANLINKANLKVKLDKGDYKAGDTILLNINTPYTGYGLITIETD
FT                   KVHNFKWFKADKNNSIQEIKIPDGFEGKGYVNVQFIRDITDTEIFISPFSYAVLPFTAG
FT                   VYKHKENIELTLLPKIKSGEKLSIRYRTTNPCKIIIFAVDEGILSFADYQTPDPINYFM
FT                   NDKALEVRTSQIMDLILPEHHLLMKSYIASPPGDSFINVSRNLNPFKRNSQPPVTFWSG
FT                   ILESDLNEREITFDIPSYFNGTLRVIGIASSLDTIGVSKTDLLVQSDLIINTNLPLFVA
FT                   PNDEFAVPITIFNNLKDSGNAQIFLNIETSEGLEILDYPKAIQIDENNEATINVKLKAT
FT                   DKLGSANLNVVASINNIKTDITSMTLVHSSELTSTTSVRPASPNITTVDTGFIPGNKAN
FT                   LKILRDLYPKFAKLQISASKSPLAIISGFKDFLDNYHYGCTEQLVSQNFANVLLYNEQE
FT                   LVQILKTDRKKMDESLSKIFQTLLERQNDDGGFRYWNNFYDDSDPFISVYTMHFLNEGV
FT                   TRYLAVPSDMFNAGLYYLENIANREINSLDEAREKAYAIYILTRNSIITTNYIANILKY
FT                   LDEYHKNTWHDDLISVYLASSYKMLKMDEDADKLLDRFTLNKPISKTNYQYYNQLIKYS
FT                   QYLYLISLHFPERLKNFDSKIIQDIALFAKDNYNSLSASYAIMASLTYAAKIHNVDEAT
FT                   IKVTDTDKVVTLKGDKVMISELSLESNEIDLTSSSNGFFYQLLTSGYDKQLKGNKEIVQ
FT                   GIEITKKYLDENNKEVSKVKLGDNITVNITINSASNKTLSNIVILDLLPGGFELLQDNN
FT                   NLNILERHQEIMIWKPIYINNRDDRVMIFGTISDQKMTYRYKIKAVNKGIFTTTAVYGQ
FT                   AMYDTQTYYRGSIGCIIVE"
     MKNICCKCVL TIFLYLINLQ VIATSFNEKI PVYLKLTNEK MLAGKNSLNI DLCDSRIKEW        60
     CAKPQREMGL NRQKINEYIS ISPDIKGEWR FGWNYNINFI PEENFLPNQT YKITIKDSIF       120
     PNFISLKKNN ISFTSLPLLS MIKEMNYLQD NINISQKFVQ TKIAFNYPID PKSLEERIEF       180
     IKSSTKEKLS FSIKFNTDKT EAISITNIPP LTDKKDIVSI IIKDGVKILY GDEIFTQKNV       240
     DIQNNKMMQN NIRYSYKENV LIPSLSSYLK ITNSTATIVK DDKLKPEQII IITTNTPVSG       300
     EEVKKHLELF LLPKNKPHFL GVAGKKNYKW QSPREITDDI LKLSEKINFE LLPAVPKITN       360
     VHHFKVDTLA SRTVLIKIKK GVRTLDNLTL GSDYTQIIQI PDNPKEVKFM SDGSILSLSG       420
     KKKLPVYSLG IDKLYVEIDK IHQQEINHLI SQTNRYNIFQ NPTFINEYSF NEYNISDVFQ       480
     EEVIVNSQNL NLPHYTDLDF SKYLHLEQAG RYSKGLFLAK VYSKDNNNNI ISQDKRLILV       540
     TDLGFIVKTD KTGTHHIFVS YISNGKPAEG VKADIIGLNG EILVSSKTDS QGHTVLSNIR       600
     DLNKGKIPIA YVLTTKDDFS FMPYNRVDQQ VNYSRFDISG TVNSEEGLKA YLFSDRGIYR       660
     PSEQGHIGIM LKQNDWHGKF DGLPLGIQVT NPYGRVIDKN KIVLNSEGLG EYLFTTFDDS       720
     LTGLYNISLY LGEPGINNYL NSVSVRVGDF QPDRMKININ FNNSKDTLWT HPKDLKATVK       780
     LINLYGIPAE NRKVRGLIDI RPTEFFVANF KEYTFYRSKD NKEFFNEHLG DVTTDSTGTA       840
     NFDLNLDKYY NATFNLTFSA EGFEPDSGRS VQGSKSLIVS PLPYIIGFRS NSNLKYIKKQ       900
     VISTIEFIAI SNKAKKVSAH NLTLKLNKIN YVNNLVSDSN GNYSYSAVPV ETNISSDNVN       960
     ITENEGYIYN VPTNEEGDYV IYLTDTENRI FAQTEFSVIG EGNVTANLIN KANLKVKLDK      1020
     GDYKAGDTIL LNINTPYTGY GLITIETDKV HNFKWFKADK NNSIQEIKIP DGFEGKGYVN      1080
     VQFIRDITDT EIFISPFSYA VLPFTAGVYK HKENIELTLL PKIKSGEKLS IRYRTTNPCK      1140
     IIIFAVDEGI LSFADYQTPD PINYFMNDKA LEVRTSQIMD LILPEHHLLM KSYIASPPGD      1200
     SFINVSRNLN PFKRNSQPPV TFWSGILESD LNEREITFDI PSYFNGTLRV IGIASSLDTI      1260
     GVSKTDLLVQ SDLIINTNLP LFVAPNDEFA VPITIFNNLK DSGNAQIFLN IETSEGLEIL      1320
     DYPKAIQIDE NNEATINVKL KATDKLGSAN LNVVASINNI KTDITSMTLV HSSELTSTTS      1380
     VRPASPNITT VDTGFIPGNK ANLKILRDLY PKFAKLQISA SKSPLAIISG FKDFLDNYHY      1440
     GCTEQLVSQN FANVLLYNEQ ELVQILKTDR KKMDESLSKI FQTLLERQND DGGFRYWNNF      1500
     YDDSDPFISV YTMHFLNEGV TRYLAVPSDM FNAGLYYLEN IANREINSLD EAREKAYAIY      1560
     ILTRNSIITT NYIANILKYL DEYHKNTWHD DLISVYLASS YKMLKMDEDA DKLLDRFTLN      1620
     KPISKTNYQY YNQLIKYSQY LYLISLHFPE RLKNFDSKII QDIALFAKDN YNSLSASYAI      1680
     MASLTYAAKI HNVDEATIKV TDTDKVVTLK GDKVMISELS LESNEIDLTS SSNGFFYQLL      1740
     TSGYDKQLKG NKEIVQGIEI TKKYLDENNK EVSKVKLGDN ITVNITINSA SNKTLSNIVI      1800
     LDLLPGGFEL LQDNNNLNIL ERHQEIMIWK PIYINNRDDR VMIFGTISDQ KMTYRYKIKA      1860
     VNKGIFTTTA VYGQAMYDTQ TYYRGSIGCI IVE                                   1893
//

If you have problems or comments...

PBIL Back to PBIL home page