(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE529

AE017197.PE529       Location/Qualifiers
FT   CDS             712732..714501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0551"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04019"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WH3"
FT                   /protein_id="AAU04019.1"
FT                   /translation="MRKQMLKIISIITIYLLLNSCSESTRDVNGLLTDSQSTIIRDYII
FT                   SQNSKNLKVNLKEKFGSNLKGVKLIGIKLTNEDLSGIDFTSCEILRTDFSGSNLDKAIL
FT                   TNAVIQESNFTDSVIKNISGYNADFQGSIFNNITLQNTNFVQSNFSDTAFNKTTIINVN
FT                   FENSKFSNVLWCNSNIDSSNFQKTNLKNNSFKNTNVINSIFYGTDLGKSVINNTNFTNN
FT                   YFESSDLSNTKFTAVIIKDSNFTQSIFNSVNFNNIQSNNSFFSYASFEDSTLQNINLTK
FT                   CDLQNSTISSAVLNHFKIDNAILNNMSFNDNTFNNLSIKNSNTNFVRINKSKGLNITLI
FT                   NTTCSNNIYSNNDLKEFKVINTDFNNSEIINSNFTNGQFNNVNFSKSLIQNVNFTDIKI
FT                   TLGNLNQVALINANLINTNIINSVLANSQINNINYQAYSSFINTNLSNNIIINDSADKI
FT                   PPNKILHNNIVINSVKDLQKISNLANMNLTNLNLSNLVFNGVDFSNSIFKKANLTNTVI
FT                   KNSILKETNFSAAILTKTDFSKSILTGSIFKCAKIDQTFFSNADLTNTDFTEVTIKNTT
FT                   FDNANTNGIKGLE"
     MRKQMLKIIS IITIYLLLNS CSESTRDVNG LLTDSQSTII RDYIISQNSK NLKVNLKEKF        60
     GSNLKGVKLI GIKLTNEDLS GIDFTSCEIL RTDFSGSNLD KAILTNAVIQ ESNFTDSVIK       120
     NISGYNADFQ GSIFNNITLQ NTNFVQSNFS DTAFNKTTII NVNFENSKFS NVLWCNSNID       180
     SSNFQKTNLK NNSFKNTNVI NSIFYGTDLG KSVINNTNFT NNYFESSDLS NTKFTAVIIK       240
     DSNFTQSIFN SVNFNNIQSN NSFFSYASFE DSTLQNINLT KCDLQNSTIS SAVLNHFKID       300
     NAILNNMSFN DNTFNNLSIK NSNTNFVRIN KSKGLNITLI NTTCSNNIYS NNDLKEFKVI       360
     NTDFNNSEII NSNFTNGQFN NVNFSKSLIQ NVNFTDIKIT LGNLNQVALI NANLINTNII       420
     NSVLANSQIN NINYQAYSSF INTNLSNNII INDSADKIPP NKILHNNIVI NSVKDLQKIS       480
     NLANMNLTNL NLSNLVFNGV DFSNSIFKKA NLTNTVIKNS ILKETNFSAA ILTKTDFSKS       540
     ILTGSIFKCA KIDQTFFSNA DLTNTDFTEV TIKNTTFDNA NTNGIKGLE                   589
//

If you have problems or comments...

PBIL Back to PBIL home page