(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE547

AE017197.PE547       Location/Qualifiers
FT   CDS             738635..739495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04037"
FT                   /db_xref="InterPro:IPR006356"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WF5"
FT                   /protein_id="AAU04037.1"
FT                   /translation="MKTLNYKNIFDVINDYDVFLFDLWGVIIEGNHTYPGVVQNINKII
FT                   AQKKVYFVTNAPRNIFSLHKTIKSWGINALPEMIISSGEIAVQMILESKKRFNIKKPII
FT                   YHLGHLENDIINVMQCYTTDDINKANISLITIYRDENEKLDLNEFDELFKIIVQRKIIN
FT                   ICANPDLGINQHGIYRYCSGYYAEKIKQLGGKVIYSGKPYSEIYHKILKECSNIPKNRM
FT                   LMIGDTFYTDILAANRLGFDSALVLTGNSREYHFDFDNINEKLDSLMKAAIKQSIIPNF
FT                   VVDLS"
     MKTLNYKNIF DVINDYDVFL FDLWGVIIEG NHTYPGVVQN INKIIAQKKV YFVTNAPRNI        60
     FSLHKTIKSW GINALPEMII SSGEIAVQMI LESKKRFNIK KPIIYHLGHL ENDIINVMQC       120
     YTTDDINKAN ISLITIYRDE NEKLDLNEFD ELFKIIVQRK IINICANPDL GINQHGIYRY       180
     CSGYYAEKIK QLGGKVIYSG KPYSEIYHKI LKECSNIPKN RMLMIGDTFY TDILAANRLG       240
     FDSALVLTGN SREYHFDFDN INEKLDSLMK AAIKQSIIPN FVVDLS                      286
//

If you have problems or comments...

PBIL Back to PBIL home page