(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE55

AE017197.PE55        Location/Qualifiers
FT   CDS             78320..78880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0059"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03545"
FT                   /db_xref="InterPro:IPR010421"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XU7"
FT                   /protein_id="AAU03545.1"
FT                   /translation="MNSQKTLPLLPRATAIWLIENTSLTFKQIADFCGIHEFEIKGMAD
FT                   GEVAQSIKGLNPIANGQLTLEEIERCSKDPNTNLQISYSPADELMQNQKKHRAKYIPIA
FT                   RRQDKPDAIYWLLSNYPNIQDHQIIKLIGTTKATIDAIRTRNHWNMHSIRPRDPVLLGI
FT                   CSQIDLNKIVENIKLPQNSIKES"
     MNSQKTLPLL PRATAIWLIE NTSLTFKQIA DFCGIHEFEI KGMADGEVAQ SIKGLNPIAN        60
     GQLTLEEIER CSKDPNTNLQ ISYSPADELM QNQKKHRAKY IPIARRQDKP DAIYWLLSNY       120
     PNIQDHQIIK LIGTTKATID AIRTRNHWNM HSIRPRDPVL LGICSQIDLN KIVENIKLPQ       180
     NSIKES                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page