(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE551

AE017197.PE551       Location/Qualifiers
FT   CDS             745873..746469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0576"
FT                   /product="Sco2-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04041"
FT                   /db_xref="GOA:Q68WF1"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WF1"
FT                   /protein_id="AAU04041.1"
FT                   /translation="MKIIIIVSLLIVVGTLYVLLSLSTPKKPLAGQVNIYKDNIKIGEA
FT                   FELIDQNGEIFNSNKLRGHLSLIYFGFTSCPDICPTFLNKMTNIVEILHQNQIDIIPIF
FT                   ITIDPKRDTPEVLKEYIKNFHPKFICLTGNEHQIKDVTDKFKILYARVNGYDDDQNYMI
FT                   DHSSFTYLIDKNGKYIKHFYLDISAKEIMEFLRNE"
     MKIIIIVSLL IVVGTLYVLL SLSTPKKPLA GQVNIYKDNI KIGEAFELID QNGEIFNSNK        60
     LRGHLSLIYF GFTSCPDICP TFLNKMTNIV EILHQNQIDI IPIFITIDPK RDTPEVLKEY       120
     IKNFHPKFIC LTGNEHQIKD VTDKFKILYA RVNGYDDDQN YMIDHSSFTY LIDKNGKYIK       180
     HFYLDISAKE IMEFLRNE                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page