(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE554

AE017197.PE554       Location/Qualifiers
FT   CDS             747676..749199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0579"
FT                   /product="MviN-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04044"
FT                   /db_xref="GOA:Q68WE8"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WE8"
FT                   /protein_id="AAU04044.1"
FT                   /translation="MTLFRSGIVVAFFTLISRIFGLVREQFIASLFGSTPIGDSINIAF
FT                   KLPNLFRRIFAEGALSSVFIPIYNEKMLISKKAANNFSGKVFTLLFLILIVTIALMQIF
FT                   MPQLILFIAPGFYAKKEKFELTVFLCRITIPYLIFVSLTALLGGILNSVKKFAAFAFSP
FT                   IILSVCVIIFTLIFENYIESTISISVSLIIAGILQVVFMFICVKRADLHFPIIFYTNDP
FT                   DVKKLLINMGPATISSGIQQLNLFISQSIASFIEGAISILAYADRIYQFPLSIIGASFS
FT                   TILLPAMSKVYKSNDIVSAQKIQNNSIRIGLLLSLPATFGIIILSHPITHIIYERGVFT
FT                   HQDTTNTAEAISAFALGLPAFILAKILTPIFYANGDTKTPLKITLFSIIMNTNMNLLLM
FT                   DSLKHIGIAVGTSIAAWYNLGLLYSYSTKQHKLHIDAGIKLFCSKILLCCTLMSIIISL
FT                   IKYYYLEYMYSEYLLIKVAMLGSTITIGVATFFGAAYLLKVVNYDNSTK"
     MTLFRSGIVV AFFTLISRIF GLVREQFIAS LFGSTPIGDS INIAFKLPNL FRRIFAEGAL        60
     SSVFIPIYNE KMLISKKAAN NFSGKVFTLL FLILIVTIAL MQIFMPQLIL FIAPGFYAKK       120
     EKFELTVFLC RITIPYLIFV SLTALLGGIL NSVKKFAAFA FSPIILSVCV IIFTLIFENY       180
     IESTISISVS LIIAGILQVV FMFICVKRAD LHFPIIFYTN DPDVKKLLIN MGPATISSGI       240
     QQLNLFISQS IASFIEGAIS ILAYADRIYQ FPLSIIGASF STILLPAMSK VYKSNDIVSA       300
     QKIQNNSIRI GLLLSLPATF GIIILSHPIT HIIYERGVFT HQDTTNTAEA ISAFALGLPA       360
     FILAKILTPI FYANGDTKTP LKITLFSIIM NTNMNLLLMD SLKHIGIAVG TSIAAWYNLG       420
     LLYSYSTKQH KLHIDAGIKL FCSKILLCCT LMSIIISLIK YYYLEYMYSE YLLIKVAMLG       480
     STITIGVATF FGAAYLLKVV NYDNSTK                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page