(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE56

AE017197.PE56        Location/Qualifiers
FT   CDS             complement(79064..79882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03546"
FT                   /db_xref="GOA:Q68XU6"
FT                   /db_xref="InterPro:IPR016428"
FT                   /db_xref="InterPro:IPR029139"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XU6"
FT                   /protein_id="AAU03546.1"
FT                   /translation="MPLSTSLLGKKSTYKDSYDATLLFKIPRINNRNVLGINNNLPFYG
FT                   VDIWNTYEISCLNKNGKPLVGIGTFYIPADSENIVESKSFKLYLNSFNNFIVKSIEELE
FT                   QIILQDLSNVTCAKVTGRIFPINTKIEFGIPSGKNIDNLDIVCNNYGPPDNSLIEYEDV
FT                   LVEEEIHSNLLKSNCLVTGQPDWGTIVIKYKGKKLKYDSFLRYLISFRNCNEFAEQCAE
FT                   RIFIDIKNAINLDFLSIYIVYTRRGGIDICPYRSTDKSYALPSNKRFIRQ"
     MPLSTSLLGK KSTYKDSYDA TLLFKIPRIN NRNVLGINNN LPFYGVDIWN TYEISCLNKN        60
     GKPLVGIGTF YIPADSENIV ESKSFKLYLN SFNNFIVKSI EELEQIILQD LSNVTCAKVT       120
     GRIFPINTKI EFGIPSGKNI DNLDIVCNNY GPPDNSLIEY EDVLVEEEIH SNLLKSNCLV       180
     TGQPDWGTIV IKYKGKKLKY DSFLRYLISF RNCNEFAEQC AERIFIDIKN AINLDFLSIY       240
     IVYTRRGGID ICPYRSTDKS YALPSNKRFI RQ                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page