(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE565

AE017197.PE565       Location/Qualifiers
FT   CDS             766134..767630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0590"
FT                   /product="patatin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04055"
FT                   /db_xref="GOA:Q68WD7"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WD7"
FT                   /protein_id="AAU04055.1"
FT                   /translation="MVDISNTKKSSLAILEGGGVKGEIHLEKLKVIEQITGKPTCKVFD
FT                   FTGGTSVGGLILILLNLPDPNNPGKPLFSAEQAQKLFEGMVHNIFPEGLTFRKLWSCNG
FT                   LFSYKFSPEPLVKLLKKYCKDYTLKDLIGEVIVTGYDLNNKQNPLITFSTIEARKSQDN
FT                   DYYLSDIIQGITAAPGYFPSHHFSNITNTKLHTIIDGGIYANDPTLQTWQLLKANECKI
FT                   DNALYLSLKEENNADYKTVCCGGGILELLKNNMPHKILAATQQADEITAQRIFGDKLIE
FT                   IPTYIPEKHAEMSDSSIENLQALKEFAKKSIYESSYFREALYNEKFKEVIDTIINNYNA
FT                   NNPQDKIVMNDAYKKLFHINTSNNGFDKSYANVEDITHNEDIVDAPIAQALDAKNTKDI
FT                   AHDKEEVLAGIKKFFDSFVEKNPETKIDIENFLNEIQNYTLEEIKNCIVSFKLASSKWQ
FT                   DTQNNLDVFSSCSMQALKEDISLEGEEHTDDVPGYNEIVA"
     MVDISNTKKS SLAILEGGGV KGEIHLEKLK VIEQITGKPT CKVFDFTGGT SVGGLILILL        60
     NLPDPNNPGK PLFSAEQAQK LFEGMVHNIF PEGLTFRKLW SCNGLFSYKF SPEPLVKLLK       120
     KYCKDYTLKD LIGEVIVTGY DLNNKQNPLI TFSTIEARKS QDNDYYLSDI IQGITAAPGY       180
     FPSHHFSNIT NTKLHTIIDG GIYANDPTLQ TWQLLKANEC KIDNALYLSL KEENNADYKT       240
     VCCGGGILEL LKNNMPHKIL AATQQADEIT AQRIFGDKLI EIPTYIPEKH AEMSDSSIEN       300
     LQALKEFAKK SIYESSYFRE ALYNEKFKEV IDTIINNYNA NNPQDKIVMN DAYKKLFHIN       360
     TSNNGFDKSY ANVEDITHNE DIVDAPIAQA LDAKNTKDIA HDKEEVLAGI KKFFDSFVEK       420
     NPETKIDIEN FLNEIQNYTL EEIKNCIVSF KLASSKWQDT QNNLDVFSSC SMQALKEDIS       480
     LEGEEHTDDV PGYNEIVA                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page