(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE575

AE017197.PE575       Location/Qualifiers
FT   CDS             complement(775364..777202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0600"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04065"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WC7"
FT                   /protein_id="AAU04065.1"
FT                   /translation="MQKILLQGYDINMNNTNPDIKEMRTLNDLPSAKACEYFIYAHGSE
FT                   FFYQNSHLGLLGRIQLYFMPDPSYLSVSILSDEGVTSMLDITLLNKIQRNTPVNQCNIV
FT                   HIFSCHSGAAQHHLNFIEGNIVLCTYNKASDSNVIQLAKSNYETRTKNHSSLIEYIHDN
FT                   FHLLVASDFSISYKLDNKIYNFSFSADKIKNMKSIEELPSFLYKEYGIFVEFYKNIYAQ
FT                   YHKSYPEIFNSSIETKPKGLTYADLIRVFNRALTLEVYNFNKFSLRKIENMLNQKGLNT
FT                   DFSIDQAIEQENFELLISLLNYDNTKIQFYTVNKAIEKGNLDILKAVLEHSTTNIIPYN
FT                   IERVIEKGNLDILKAVLEHSTIKIESNNVDTAIEKGNLDLLKAVLEHNTTKIESYNIDR
FT                   AIVKGNLDIFKAVLEHSTTKIESYNFDKIIEKGNLDIFKAALEHSTIKIESYNFDKIIE
FT                   KGNLDIVKAVLAHSTTKIESYNINKAIEKSNLDILKAVLEHSTAKIESYNIERAIEKGN
FT                   LDILKAVLEHSTAKMYSYNFDTVIKTGNLEMLDMVLQHLDIAVDSYNIYVAQRTNNLEV
FT                   IELIKKYHNHTINNIMPEVYSSIEEDVTILGAEIVQ"
     MQKILLQGYD INMNNTNPDI KEMRTLNDLP SAKACEYFIY AHGSEFFYQN SHLGLLGRIQ        60
     LYFMPDPSYL SVSILSDEGV TSMLDITLLN KIQRNTPVNQ CNIVHIFSCH SGAAQHHLNF       120
     IEGNIVLCTY NKASDSNVIQ LAKSNYETRT KNHSSLIEYI HDNFHLLVAS DFSISYKLDN       180
     KIYNFSFSAD KIKNMKSIEE LPSFLYKEYG IFVEFYKNIY AQYHKSYPEI FNSSIETKPK       240
     GLTYADLIRV FNRALTLEVY NFNKFSLRKI ENMLNQKGLN TDFSIDQAIE QENFELLISL       300
     LNYDNTKIQF YTVNKAIEKG NLDILKAVLE HSTTNIIPYN IERVIEKGNL DILKAVLEHS       360
     TIKIESNNVD TAIEKGNLDL LKAVLEHNTT KIESYNIDRA IVKGNLDIFK AVLEHSTTKI       420
     ESYNFDKIIE KGNLDIFKAA LEHSTIKIES YNFDKIIEKG NLDIVKAVLA HSTTKIESYN       480
     INKAIEKSNL DILKAVLEHS TAKIESYNIE RAIEKGNLDI LKAVLEHSTA KMYSYNFDTV       540
     IKTGNLEMLD MVLQHLDIAV DSYNIYVAQR TNNLEVIELI KKYHNHTINN IMPEVYSSIE       600
     EDVTILGAEI VQ                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page