(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE67

AE017197.PE67        Location/Qualifiers
FT   CDS             complement(93161..93472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0071"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03557"
FT                   /db_xref="GOA:Q68XT5"
FT                   /db_xref="InterPro:IPR022718"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XT5"
FT                   /protein_id="AAU03557.1"
FT                   /translation="MSLTQILLSLFVVILVIKPHDLFLIIKKFKTIKAFVIRSFFINTI
FT                   DESLETEQINFYLKRIINLEGYYYGNYDLTTIKEKYYTLIVNNAFIEKESVHDIIEKH"
     MSLTQILLSL FVVILVIKPH DLFLIIKKFK TIKAFVIRSF FINTIDESLE TEQINFYLKR        60
     IINLEGYYYG NYDLTTIKEK YYTLIVNNAF IEKESVHDII EKH                         103
//

If you have problems or comments...

PBIL Back to PBIL home page