(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE95

AE017197.PE95        Location/Qualifiers
FT   CDS             131548..132207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0099"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03585"
FT                   /db_xref="InterPro:IPR020171"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XQ7"
FT                   /protein_id="AAU03585.1"
FT                   /translation="MTNNQFSEETKKIADQIKDSLMGISDNLILESKEVEEIFEELSKN
FT                   EEFDYEIERILAILNEQTMDLTQLQSRIILLIRKYLDKTKNLKFKMDEKLINKNVAEVS
FT                   NYLMHQHSKIVRDANKNLVKPKDKLQSLTKQARMDLKRLIKSFAVYQVYMFMNPKRIAG
FT                   ETKLMNFAYNMIKGGMKLAKKYEGGKEKDIKSYSPRLIKKLEKAHAGFKKNNSISI"
     MTNNQFSEET KKIADQIKDS LMGISDNLIL ESKEVEEIFE ELSKNEEFDY EIERILAILN        60
     EQTMDLTQLQ SRIILLIRKY LDKTKNLKFK MDEKLINKNV AEVSNYLMHQ HSKIVRDANK       120
     NLVKPKDKLQ SLTKQARMDL KRLIKSFAVY QVYMFMNPKR IAGETKLMNF AYNMIKGGMK       180
     LAKKYEGGKE KDIKSYSPRL IKKLEKAHAG FKKNNSISI                              219
//

If you have problems or comments...

PBIL Back to PBIL home page