(data stored in SCRATCH3701 zone)

EMBL: AE017197.PKCI

AE017197.PKCI        Location/Qualifiers
FT   CDS             complement(390257..390619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pkcI"
FT                   /locus_tag="RT0307"
FT                   /product="protein kinase C inhibitor 1"
FT                   /db_xref="EnsemblGenomes-Gn:RT0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03787"
FT                   /db_xref="GOA:Q68X55"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X55"
FT                   /protein_id="AAU03787.1"
FT                   /translation="MYNKENVFAKIITKNLPAEIIYEDKQILAFKDIEPIAPVHIIVIP
FT                   KNEYIDYTDFISKASIDEIKHFFAKISDIANEAGLAKAGYRLITNKGEKSGQTIFHFHF
FT                   HIIGGKKLIGLINNND"
     MYNKENVFAK IITKNLPAEI IYEDKQILAF KDIEPIAPVH IIVIPKNEYI DYTDFISKAS        60
     IDEIKHFFAK ISDIANEAGL AKAGYRLITN KGEKSGQTIF HFHFHIIGGK KLIGLINNND       120
//

If you have problems or comments...

PBIL Back to PBIL home page